Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100695
Name   oriT_p6409-151.583kb in_silico
Organism   Escherichia coli strain 6409
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP010372 (31089..31378 [-], 290 nt)
oriT length   290 nt
IRs (inverted repeats)      225..232, 235..242 n  (GCAAAAAC..GTTTTTGC)
Location of nic site      251..252
Conserved sequence flanking the
  nic site    		  GTGGGGTGT|GG
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 290 nt

>oriT_p6409-151.583kb
CGCACCGCTAGCAGCGCCCCTAGCGGTATCCTATAAAAAAACACACCGCGCCGCTAGCAGCACCCCTAATATAAAATAATGTTTTTTATAAAAATAGTCAGTACCACCCCTACAAAGCGGTGTCGGCGCGTTGTTGTAGCCGCGCCGACACCGCTTTTTTAAATATCATAAAGAGAGTAAGAGAAACTAATTTTTCATAACTCTCTATTTATAAAGAAAAATCAGCAAAAACTTGTTTTTGCGTGGGGTGTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTTGAGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   767 GenBank   WP_013362805
Name   TraI_p6409-151.583kb insolico UniProt ID   _
Length   1706 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 1706 a.a.        Molecular weight: 186742.95 Da        Isoelectric Point: 5.9554

>WP_013362805.1 MULTISPECIES: conjugative transfer relaxase/helicase TraI [Enterobacteriaceae]
MMSIAQVRSAGSAGNYYTDKDNYYVLGSMGERWAGRGAEQLGLQGSVDKDVFTRLLEGRLPDGADLSRMQ
DGSNKHRPGYDLTFSAPKSVSMMAMLGGDKRLIDAHNQAVDFAVRQVEALASTRVMTDGQSETVLTGNLV
MALFNHDTSRDQEPQLHTHAVVANVTQHNGEWKTLSSDKVGKTGFIENVYANQIAFGRLYREKLKEQVEA
LGYETEVVGKHGMWEMPGVPVEAFSGRSQTIRETVGEDASLKSRDVAALDTRKSKQHVDPEIKMTEWMQT
LKETGFDIRAYRDAAEQRAYTRTQTPGPASQDGPDVQQAVTQAIAGLSERKVQFTYTDVLARTVGILPPE
AGVIERARAGIDEAISREQLIPLDREKGMFTSGIHVLDELSVRALSRDIMKQNRVTVHPEKSVPRTAGYS
DAVSVLAQDRPSLAIVSGQGGAAGQRERVAELAMMAREQGREVQIIAADRRSQMNLKQDERLSGELITGR
RQLQEGMAFTPGSTVIVDQGEKLSLKETLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKYAGVNTYRW
QGGEQRPATIISEPDRNVRYDRLAGDFAASVKAGEESVAQVSGVREQAILTQAIRSELKTQGVLGHPEVT
MTALSPVWLDSRSRYLRDMYRPGMVMEQWNPETRSHDRYVIDRVTAQSHSLTLRDAQGETQVVRISSLDS
SWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVASVSEDAMTVVVPGRAEPATLPVADSPFTALKL
ENGWVETPGHSVSDSATVFASVTQMAMDNATLNGLARSGRDVRLYSSLDETRTAEKLARHPSFTVVSEQI
KARAGETSLETAISLQKTGLHTPAQQAIHLALPVLESKNLAFSMVDLLTEAKSFAAEGTGFTELGGEINA
QIKRGDLLYVDVAKGYGTGLLVSRASYEAEKSILRHILEGKEAVTPLMERVPGELMETLTSGQRAATRMI
LETSDRFTVVQGYAGVGKTTQFRAVMSAVNMLPESERPRVVGLGPTHRAVGEMRSAGVDAQTLASFLHDT
QLQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIAAGGGRAVASGDTDQLQAIAPGQPFRLQQTRSA
ADVAIMKEIVRQTPELREAVYSLINRDVEKALSGLESVKPSQVPRLEGAWAPEHSVTEFSHSQEAKLAEA
QQKAMLKGEAFPDIPMTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIHDAREKAGELGKEQVM
VPVLNTANIRDGELRRLSTWENNPDALALVDSVYHRIAGISKDDGLITLEDAEGNTRLISPREAVAEGVT
LYTPDKIRVGTGDRMRFTKSDRERGYVANSVWTVTAVSGDSVTLSDGQQTRVIRPGQERAEQHIDLAYAI
TAHGAQGASETFAIALEGTEGNRKLMAGFESAYVALSRMKQHVQVYTDNRQGWTDAINNAVQKGTAHDVL
EPKPDREVMNAQRLFSTARELRDVAAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDRNGRSAG
IWLNPLTTDDGNGLRGFSGEGRPWNPGAITGGRVWGDIPDNSVQPGAGNGEPVTAEVLAQRQAEEAIRRE
TERRADEIVRKMAENKPDLPDGKTELAVRDIAGQERDRTATSERETALPESVLRESQREREAVREVAREN
LLQRLLQQMERDMVRDLQKEKTLGGD

  Protein domains


Predicted by InterproScan.

TrwC relaxase (TrwC)

(10-283)

AAA domain (AAA_30)

(968-1156)

DNA relaxase TraI 2B/2B-like domain (TraI_2B)

(633-712)

single-stranded DNA binding TraI N-terminal subdomain (ssDNA_TraI_N)

(575-626)

DNA helicase TraI (TraI_C)

(1434-1557)


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 30527..56913

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
RR31_RS23740 (RR31_23785) 25982..26215 + 234 WP_000005990 DUF905 family protein -
RR31_RS27550 26243..26440 + 198 Protein_32 hypothetical protein -
RR31_RS23745 (RR31_23790) 26495..26929 + 435 WP_000845937 conjugation system SOS inhibitor PsiB -
RR31_RS23750 (RR31_23795) 26926..27688 + 763 Protein_34 plasmid SOS inhibition protein A -
RR31_RS29260 (RR31_23800) 27657..27845 - 189 WP_001299721 hypothetical protein -
RR31_RS29645 27867..28016 + 150 Protein_36 plasmid maintenance protein Mok -
RR31_RS23760 (RR31_23805) 27958..28083 + 126 WP_001372321 type I toxin-antitoxin system Hok family toxin -
RR31_RS29650 28303..28533 + 231 WP_071886920 hypothetical protein -
RR31_RS29655 (RR31_23810) 28531..28703 - 173 Protein_39 hypothetical protein -
RR31_RS29660 (RR31_23815) 28773..28979 + 207 WP_000547968 hypothetical protein -
RR31_RS23775 (RR31_23820) 29004..29291 + 288 WP_000107535 hypothetical protein -
RR31_RS23780 (RR31_23825) 29409..30230 + 822 WP_001234426 DUF932 domain-containing protein -
RR31_RS23785 (RR31_23830) 30527..31117 - 591 WP_192849409 transglycosylase SLT domain-containing protein virB1
RR31_RS23790 (RR31_23835) 31450..31833 + 384 WP_001151524 conjugal transfer relaxosome DNA-binding protein TraM -
RR31_RS23795 (RR31_23840) 32020..32709 + 690 WP_000283385 conjugal transfer transcriptional regulator TraJ -
RR31_RS23800 (RR31_23845) 32808..33203 + 396 WP_001309237 conjugal transfer relaxosome DNA-bindin protein TraY -
RR31_RS23805 (RR31_23850) 33236..33601 + 366 WP_000994779 type IV conjugative transfer system pilin TraA -
RR31_RS23810 (RR31_23855) 33616..33927 + 312 WP_000012106 type IV conjugative transfer system protein TraL traL
RR31_RS23815 (RR31_23860) 33949..34515 + 567 WP_000399792 type IV conjugative transfer system protein TraE traE
RR31_RS23820 (RR31_23865) 34502..35230 + 729 WP_001230787 type-F conjugative transfer system secretin TraK traK
RR31_RS23825 (RR31_23870) 35230..36657 + 1428 WP_040110342 F-type conjugal transfer pilus assembly protein TraB traB
RR31_RS23830 (RR31_23875) 36647..37237 + 591 WP_000002787 conjugal transfer pilus-stabilizing protein TraP -
RR31_RS23835 (RR31_23880) 37224..37421 + 198 WP_001324648 conjugal transfer protein TrbD -
RR31_RS23840 (RR31_23885) 37433..37684 + 252 WP_001038342 conjugal transfer protein TrbG -
RR31_RS23845 (RR31_23890) 37681..38196 + 516 WP_000809838 type IV conjugative transfer system lipoprotein TraV traV
RR31_RS27565 (RR31_23895) 38331..38552 + 222 WP_001278689 conjugal transfer protein TraR -
RR31_RS23855 (RR31_23900) 38712..41339 + 2628 WP_001064245 type IV secretion system protein TraC virb4
RR31_RS23860 (RR31_23905) 41336..41722 + 387 WP_000099686 type-F conjugative transfer system protein TrbI -
RR31_RS23865 (RR31_23910) 41719..42351 + 633 WP_001203720 type-F conjugative transfer system protein TraW traW
RR31_RS23870 (RR31_23915) 42348..43340 + 993 WP_000830180 conjugal transfer pilus assembly protein TraU traU
RR31_RS23875 (RR31_23920) 43349..43987 + 639 WP_021518374 type-F conjugative transfer system pilin assembly protein TrbC trbC
RR31_RS23880 (RR31_23925) 43984..45792 + 1809 WP_000821840 type-F conjugative transfer system mating-pair stabilization protein TraN traN
RR31_RS23885 (RR31_23930) 45819..46076 + 258 WP_000864312 conjugal transfer protein TrbE -
RR31_RS23890 (RR31_23935) 46069..46812 + 744 WP_001030378 type-F conjugative transfer system pilin assembly protein TraF traF
RR31_RS23895 (RR31_23940) 46826..47167 + 342 WP_000556794 conjugal transfer protein TrbA -
RR31_RS23900 (RR31_23945) 47148..47483 - 336 WP_000415571 hypothetical protein -
RR31_RS23905 (RR31_23950) 47564..47848 + 285 WP_000624105 type-F conjugative transfer system pilin chaperone TraQ -
RR31_RS23910 (RR31_23955) 47835..48389 + 555 WP_001553830 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
RR31_RS27570 48379..48693 + 315 WP_023149603 P-type conjugative transfer protein TrbJ -
RR31_RS23915 (RR31_23960) 48647..49039 + 393 WP_000164675 F-type conjugal transfer protein TrbF -
RR31_RS23920 (RR31_23965) 49026..50399 + 1374 WP_021518370 conjugal transfer pilus assembly protein TraH traH
RR31_RS23925 (RR31_23970) 50396..53221 + 2826 WP_001553826 conjugal transfer mating-pair stabilization protein TraG traG
RR31_RS23930 (RR31_23975) 53218..53727 + 510 WP_000628100 conjugal transfer entry exclusion protein TraS -
RR31_RS23935 (RR31_23980) 53741..54472 + 732 WP_000850424 conjugal transfer complement resistance protein TraT -
RR31_RS23940 (RR31_23985) 54724..56913 + 2190 WP_040110343 type IV conjugative transfer system coupling protein TraD virb4

Host bacterium

ID   1155 GenBank   NZ_CP010372
Plasmid name   p6409-151.583kb Incompatibility group   IncFIA
Plasmid size   151583 bp Coordinate of oriT [Strand]   31089..31378 [-]
Host baterium   Escherichia coli strain 6409

Cargo genes

Drug resistance gene   catA1, tet(B), qacE, sul1, blaTEM-1B, sitABCD
Virulence gene   iucC, iutA, iucA, iucB
Metal resistance gene   merE, merD, merA, merP, merT, merR
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -