Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 100693 |
| Name | oriT_p34978-70.092kb  |
| Organism | Enterobacter hormaechei subsp. xiangfangensis strain 34978 |
| Sequence Completeness | core |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP010365 (13316..13420 [-], 105 nt) |
| oriT length | 105 nt |
| IRs (inverted repeats) | 18..35, 42..59 (GTTTTTGGTACACCGCCG..CGGCAGTGACGCAAAAAC) |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | predicted by the oriTfinder |
oriT sequence
Download Length: 105 nt
>oriT_p34978-70.092kb
AGTACGGGACAAGATGTGTTTTTGGTACACCGCCGGCACGCCGGCAGTGACGCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTAT
AGTACGGGACAAGATGTGTTTTTGGTACACCGCCGGCACGCCGGCAGTGACGCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTAT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Relaxase
| ID | 765 | GenBank | WP_004206924 |
| Name | Putativerelaxaseofp34978-70.092kb |
UniProt ID | _ |
| Length | 659 a.a. | PDB ID | |
| Note | putative relaxase | ||
Relaxase protein sequence
Download Length: 659 a.a. Molecular weight: 75087.84 Da Isoelectric Point: 10.0285
>WP_004206924.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFAGIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQLRSESDDKFNPK
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFAGIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQLRSESDDKFNPK
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 610..10518
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LI63_RS00845 (LI63_00965) | 610..1959 | - | 1350 | WP_004206932 | conjugal transfer protein TraO | traO |
| LI63_RS25080 (LI63_01605) | 1971..3122 | - | 1152 | WP_015062843 | DotH/IcmK family type IV secretion protein | traN |
| LI63_RS00860 (LI63_00975) | 3131..3844 | - | 714 | WP_223294958 | DotI/IcmL family type IV secretion protein | traM |
| LI63_RS00865 (LI63_00980) | 3912..4322 | + | 411 | WP_004187465 | H-NS family nucleoid-associated regulatory protein | - |
| LI63_RS25325 | 4351..4506 | + | 156 | WP_172693602 | Hha/YmoA family nucleoid-associated regulatory protein | - |
| LI63_RS00870 | 4507..5019 | - | 513 | WP_011091071 | hypothetical protein | traL |
| LI63_RS27135 | 4985..8290 | - | 3306 | WP_219818010 | LPD7 domain-containing protein | - |
| LI63_RS00880 (LI63_01010) | 8315..8575 | - | 261 | WP_004187310 | IcmT/TraK family protein | traK |
| LI63_RS00885 (LI63_01015) | 8565..9728 | - | 1164 | WP_004206926 | plasmid transfer ATPase TraJ | virB11 |
| LI63_RS00890 (LI63_01020) | 9739..10518 | - | 780 | WP_004187315 | type IV secretory system conjugative DNA transfer family protein | traI |
| LI63_RS00895 (LI63_01025) | 10515..11015 | - | 501 | WP_004206925 | DotD/TraH family lipoprotein | - |
| LI63_RS00900 (LI63_01030) | 11029..13008 | - | 1980 | WP_004206924 | TraI/MobA(P) family conjugative relaxase | - |
| LI63_RS00905 (LI63_01035) | 12995..13312 | - | 318 | WP_004206923 | plasmid mobilization protein MobA | - |
| LI63_RS00910 (LI63_01040) | 13588..13953 | + | 366 | WP_004206922 | hypothetical protein | - |
| LI63_RS00915 (LI63_01050) | 14454..14990 | - | 537 | WP_004206920 | hypothetical protein | - |
| LI63_RS00920 (LI63_01055) | 15123..15434 | - | 312 | WP_004187333 | hypothetical protein | - |
Region 2: 53361..69962
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LI63_RS01175 (LI63_01310) | 48729..48947 | + | 219 | WP_004187411 | hypothetical protein | - |
| LI63_RS01180 (LI63_01315) | 48950..49159 | + | 210 | WP_004187413 | hypothetical protein | - |
| LI63_RS01185 (LI63_01320) | 49282..50547 | - | 1266 | WP_024190314 | translesion error-prone DNA polymerase V subunit UmuC | - |
| LI63_RS01190 (LI63_01325) | 50535..50969 | - | 435 | WP_044068898 | translesion error-prone DNA polymerase V autoproteolytic subunit | - |
| LI63_RS01195 (LI63_01330) | 51062..51427 | - | 366 | WP_020277900 | type II toxin-antitoxin system toxin endoribonuclease PemK-mt | - |
| LI63_RS26885 (LI63_01335) | 51396..51653 | - | 258 | WP_004187429 | type II toxin-antitoxin system antitoxin PemI | - |
| LI63_RS01205 (LI63_01340) | 51745..52398 | - | 654 | WP_004206890 | type II CAAX endopeptidase family protein | - |
| LI63_RS01210 (LI63_01345) | 52478..52861 | + | 384 | WP_004206889 | DUF1496 domain-containing protein | - |
| LI63_RS01215 (LI63_01350) | 53005..53361 | + | 357 | WP_015586032 | lytic transglycosylase domain-containing protein | - |
| LI63_RS01220 (LI63_01355) | 53361..54668 | + | 1308 | WP_015059988 | hypothetical protein | trbA |
| LI63_RS01225 (LI63_01360) | 54679..55629 | + | 951 | WP_004206886 | DsbC family protein | trbB |
| LI63_RS01230 (LI63_01365) | 55642..57729 | + | 2088 | WP_004206885 | conjugal transfer protein TrbC | - |
| LI63_RS27380 | 57780..57875 | - | 96 | WP_004206884 | DinQ-like type I toxin DqlB | - |
| LI63_RS01235 (LI63_01375) | 59102..60157 | - | 1056 | WP_021526650 | plasmid replication initiator RepA | - |
| LI63_RS01240 (LI63_01380) | 60454..60684 | - | 231 | WP_004187496 | IncL/M type plasmid replication protein RepC | - |
| LI63_RS01245 (LI63_01385) | 60758..61411 | - | 654 | WP_004206935 | hypothetical protein | - |
| LI63_RS01250 (LI63_01390) | 61414..63594 | - | 2181 | WP_004187492 | DotA/TraY family protein | traY |
| LI63_RS01255 (LI63_01395) | 63587..64237 | - | 651 | WP_004187488 | hypothetical protein | - |
| LI63_RS01260 (LI63_01400) | 64234..65442 | - | 1209 | WP_004187486 | conjugal transfer protein TraW | traW |
| LI63_RS01265 (LI63_01405) | 65439..68489 | - | 3051 | WP_011154474 | conjugative transfer protein | traU |
| LI63_RS01270 (LI63_01410) | 68486..68980 | - | 495 | WP_004187480 | hypothetical protein | - |
| LI63_RS01275 (LI63_01415) | 69026..69415 | - | 390 | WP_011154472 | DUF6750 family protein | traR |
| LI63_RS01280 (LI63_01420) | 69432..69962 | - | 531 | WP_004187478 | conjugal transfer protein TraQ | traQ |
Host bacterium
| ID | 1153 | GenBank | NZ_CP010365 |
| Plasmid name | p34978-70.092kb | Incompatibility group | IncL/M |
| Plasmid size | 70092 bp | Coordinate of oriT [Strand] | 13316..13420 [-] |
| Host baterium | Enterobacter hormaechei subsp. xiangfangensis strain 34978 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |