Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100675
Name   oriT_pH8-B in_silico
Organism   Escherichia coli strain H8
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP010174 (63245..63794 [-], 550 nt)
oriT length   550 nt
IRs (inverted repeats)      243..255, 257..269  (TATTTAATAATTC..GAATTATTAAATA)
 311..318, 321..328  (GCAAAAAC..GTTTTTGC)
Location of nic site      337..338
Conserved sequence flanking the
  nic site  
 
 GTAGTGTGT|GG
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 550 nt

>oriT_pH8-B
TTACTCTGGCCATAAGATAAAACCTTTCATTATTAAGCAATGAACTTTTCACTATAAATATGCATATAGTGTTTACAAGTAAGAAAGACACTCCTAGCAGCGCCTCTAGGATCATCCTATAAAAAAATGCGATCCGGCGCTAGGGGCGTCCCTAATATATATCAATGTTTTTCATGAAAATTGTCAGTACTGATCCTAATAAGAGTCGCTATAGGGTCGTAACAGGATCGCCAACGACTCTCTATTTAATAATTCAGAATTATTAAATATAAATAGCGTTTGTTAATTACATGATTTAAAACGTAAATCAGCAAAAACTTGTTTTTGCGTAGTGTGTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTTGAGCCTTTTTGTGGAGTGGGTTAAATTATTTACGGATAAAGTCACCAGAGGTGGAAAAATGAAAAAATGGATGTTAGCAATCTGCCTGATGTTTATAAATGGGATCTGCGAAGCCGCCGATTGCTTTGATCTTGCAGGTCGGGATTACAAAATAGACCCGGATTTACTGAGAGCGATATC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   747 GenBank   WP_000130000
Name   Relaxase_pH8-B insolico UniProt ID   _
Length   101 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 101 a.a.        Molecular weight: 11477.11 Da        Isoelectric Point: 7.5204

>WP_000130000.1 MULTISPECIES: PadR family transcriptional regulator [Pseudomonadota]
MTDKDLYGGLIRLHILHHAAEEPVFGLGIIEELRRHGYEMSAGTVYPMLHGLEKKGYLTSRHERTGRRER
RVYDITEQGRTALADAKTKVKELFGELVEGG

  Protein domains


Predicted by InterproScan.

(15-84)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 62857..92601

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
RG50_RS26915 (RG50_25230) 58829..59263 + 435 WP_000845953 conjugation system SOS inhibitor PsiB -
RG50_RS26920 (RG50_25235) 59260..60022 + 763 Protein_72 plasmid SOS inhibition protein A -
RG50_RS28930 (RG50_25240) 60000..60179 - 180 WP_001309233 hypothetical protein -
RG50_RS29525 60201..60350 + 150 Protein_74 plasmid maintenance protein Mok -
RG50_RS26930 (RG50_25245) 60292..60417 + 126 WP_001372321 type I toxin-antitoxin system Hok family toxin -
RG50_RS29125 60736..61032 - 297 Protein_76 hypothetical protein -
RG50_RS26950 (RG50_25260) 61332..61628 + 297 WP_001272251 hypothetical protein -
RG50_RS26955 (RG50_25265) 61739..62560 + 822 WP_001234445 DUF932 domain-containing protein -
RG50_RS26960 (RG50_25270) 62857..63459 - 603 WP_000243713 transglycosylase SLT domain-containing protein virB1
RG50_RS26965 (RG50_25275) 63782..64165 + 384 WP_001354030 conjugal transfer relaxosome DNA-binding protein TraM -
RG50_RS26970 (RG50_25280) 64359..65030 + 672 WP_000283561 conjugal transfer transcriptional regulator TraJ -
RG50_RS26975 (RG50_25285) 65167..65394 + 228 WP_000089263 conjugal transfer relaxosome protein TraY -
RG50_RS26980 (RG50_25290) 65427..65786 + 360 WP_001098992 type IV conjugative transfer system pilin TraA -
RG50_RS26985 (RG50_25295) 65801..66112 + 312 WP_000012113 type IV conjugative transfer system protein TraL traL
RG50_RS26990 (RG50_25300) 66134..66700 + 567 WP_000399780 type IV conjugative transfer system protein TraE traE
RG50_RS26995 (RG50_25305) 66687..67415 + 729 WP_001230772 type-F conjugative transfer system secretin TraK traK
RG50_RS27000 (RG50_25310) 67415..68866 + 1452 WP_000146675 F-type conjugal transfer pilus assembly protein TraB traB
RG50_RS27005 (RG50_25315) 68856..69422 + 567 WP_000896599 conjugal transfer pilus-stabilizing protein TraP -
RG50_RS27010 (RG50_25320) 69409..69729 + 321 WP_001057307 conjugal transfer protein TrbD -
RG50_RS27015 (RG50_25325) 69726..70241 + 516 WP_000809881 type IV conjugative transfer system lipoprotein TraV traV
RG50_RS27020 (RG50_25330) 70376..70597 + 222 WP_001278683 conjugal transfer protein TraR -
RG50_RS27025 (RG50_25335) 70590..71066 + 477 WP_000549587 hypothetical protein -
RG50_RS27030 (RG50_25340) 71146..71364 + 219 WP_000556745 hypothetical protein -
RG50_RS28935 (RG50_25345) 71392..71739 + 348 WP_000836682 hypothetical protein -
RG50_RS27040 (RG50_25350) 71865..74495 + 2631 WP_000069777 type IV secretion system protein TraC virb4
RG50_RS27045 (RG50_25355) 74492..74878 + 387 WP_000214084 type-F conjugative transfer system protein TrbI -
RG50_RS27050 (RG50_25360) 74875..75507 + 633 WP_001203728 type-F conjugative transfer system protein TraW traW
RG50_RS27055 (RG50_25365) 75504..76496 + 993 WP_000830838 conjugal transfer pilus assembly protein TraU traU
RG50_RS27060 (RG50_25370) 76526..76831 + 306 WP_000224416 hypothetical protein -
RG50_RS27065 (RG50_25375) 76840..77478 + 639 WP_001080256 type-F conjugative transfer system pilin assembly protein TrbC trbC
RG50_RS27070 (RG50_25380) 77475..79325 + 1851 WP_000821856 type-F conjugative transfer system mating-pair stabilization protein TraN traN
RG50_RS27075 (RG50_25385) 79352..79609 + 258 WP_000864353 conjugal transfer protein TrbE -
RG50_RS27080 (RG50_25390) 79602..80345 + 744 WP_001030371 type-F conjugative transfer system pilin assembly protein TraF traF
RG50_RS27085 (RG50_25395) 80359..80703 + 345 WP_000556796 conjugal transfer protein TrbA -
RG50_RS27090 (RG50_25400) 80822..81106 + 285 WP_000624194 type-F conjugative transfer system pilin chaperone TraQ -
RG50_RS27095 (RG50_25405) 81093..81638 + 546 WP_000059831 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
RG50_RS27100 (RG50_25410) 81568..81927 + 360 WP_073529434 P-type conjugative transfer protein TrbJ -
RG50_RS27115 (RG50_25430) 82669..83061 + 393 WP_073529438 F-type conjugal transfer protein TrbF -
RG50_RS27120 (RG50_25435) 83048..84421 + 1374 WP_000944331 conjugal transfer pilus assembly protein TraH traH
RG50_RS27125 (RG50_25440) 84418..87240 + 2823 WP_001007039 conjugal transfer mating-pair stabilization protein TraG traG
RG50_RS27130 (RG50_25445) 87256..87741 + 486 WP_000605870 hypothetical protein -
RG50_RS27135 (RG50_25450) 87790..88521 + 732 WP_000782451 conjugal transfer complement resistance protein TraT -
RG50_RS27140 (RG50_25455) 88724..89038 + 315 Protein_114 hypothetical protein -
RG50_RS27150 (RG50_25460) 89102..89806 + 705 WP_001067855 IS6-like element IS26 family transposase -
RG50_RS27160 (RG50_25465) 89855..90289 + 435 Protein_116 hypothetical protein -
RG50_RS27165 (RG50_25470) 90340..92601 + 2262 WP_046072940 type IV conjugative transfer system coupling protein TraD virb4


Host bacterium


ID   1135 GenBank   NZ_CP010174
Plasmid name   pH8-B Incompatibility group   IncR
Plasmid size   106274 bp Coordinate of oriT [Strand]   63245..63794 [-]
Host baterium   Escherichia coli strain H8

Cargo genes


Drug resistance gene   tunicamycin resistance
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -