Detailed information of oriT
oriT
The information of the oriT region
oriTDB ID | 100675 |
Name | oriT_pH8-B |
Organism | Escherichia coli strain H8 |
Sequence Completeness | intact |
NCBI accession of oriT (coordinates [strand]) | NZ_CP010174 (63245..63794 [-], 550 nt) |
oriT length | 550 nt |
IRs (inverted repeats) | 243..255, 257..269 (TATTTAATAATTC..GAATTATTAAATA) 311..318, 321..328 (GCAAAAAC..GTTTTTGC) |
Location of nic site | 337..338 |
Conserved sequence flanking the nic site |
GTAGTGTGT|GG |
Note | predicted by the oriTfinder |
oriT sequence
Download Length: 550 nt
>oriT_pH8-B
TTACTCTGGCCATAAGATAAAACCTTTCATTATTAAGCAATGAACTTTTCACTATAAATATGCATATAGTGTTTACAAGTAAGAAAGACACTCCTAGCAGCGCCTCTAGGATCATCCTATAAAAAAATGCGATCCGGCGCTAGGGGCGTCCCTAATATATATCAATGTTTTTCATGAAAATTGTCAGTACTGATCCTAATAAGAGTCGCTATAGGGTCGTAACAGGATCGCCAACGACTCTCTATTTAATAATTCAGAATTATTAAATATAAATAGCGTTTGTTAATTACATGATTTAAAACGTAAATCAGCAAAAACTTGTTTTTGCGTAGTGTGTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTTGAGCCTTTTTGTGGAGTGGGTTAAATTATTTACGGATAAAGTCACCAGAGGTGGAAAAATGAAAAAATGGATGTTAGCAATCTGCCTGATGTTTATAAATGGGATCTGCGAAGCCGCCGATTGCTTTGATCTTGCAGGTCGGGATTACAAAATAGACCCGGATTTACTGAGAGCGATATC
TTACTCTGGCCATAAGATAAAACCTTTCATTATTAAGCAATGAACTTTTCACTATAAATATGCATATAGTGTTTACAAGTAAGAAAGACACTCCTAGCAGCGCCTCTAGGATCATCCTATAAAAAAATGCGATCCGGCGCTAGGGGCGTCCCTAATATATATCAATGTTTTTCATGAAAATTGTCAGTACTGATCCTAATAAGAGTCGCTATAGGGTCGTAACAGGATCGCCAACGACTCTCTATTTAATAATTCAGAATTATTAAATATAAATAGCGTTTGTTAATTACATGATTTAAAACGTAAATCAGCAAAAACTTGTTTTTGCGTAGTGTGTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTTGAGCCTTTTTGTGGAGTGGGTTAAATTATTTACGGATAAAGTCACCAGAGGTGGAAAAATGAAAAAATGGATGTTAGCAATCTGCCTGATGTTTATAAATGGGATCTGCGAAGCCGCCGATTGCTTTGATCTTGCAGGTCGGGATTACAAAATAGACCCGGATTTACTGAGAGCGATATC
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure fileRelaxase
ID | 747 | GenBank | WP_000130000 |
Name | Relaxase_pH8-B | UniProt ID | _ |
Length | 101 a.a. | PDB ID | |
Note | putative relaxase |
Relaxase protein sequence
Download Length: 101 a.a. Molecular weight: 11477.11 Da Isoelectric Point: 7.5204
>WP_000130000.1 MULTISPECIES: PadR family transcriptional regulator [Pseudomonadota]
MTDKDLYGGLIRLHILHHAAEEPVFGLGIIEELRRHGYEMSAGTVYPMLHGLEKKGYLTSRHERTGRRER
RVYDITEQGRTALADAKTKVKELFGELVEGG
MTDKDLYGGLIRLHILHHAAEEPVFGLGIIEELRRHGYEMSAGTVYPMLHGLEKKGYLTSRHERTGRRER
RVYDITEQGRTALADAKTKVKELFGELVEGG
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 62857..92601
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RG50_RS26915 (RG50_25230) | 58829..59263 | + | 435 | WP_000845953 | conjugation system SOS inhibitor PsiB | - |
RG50_RS26920 (RG50_25235) | 59260..60022 | + | 763 | Protein_72 | plasmid SOS inhibition protein A | - |
RG50_RS28930 (RG50_25240) | 60000..60179 | - | 180 | WP_001309233 | hypothetical protein | - |
RG50_RS29525 | 60201..60350 | + | 150 | Protein_74 | plasmid maintenance protein Mok | - |
RG50_RS26930 (RG50_25245) | 60292..60417 | + | 126 | WP_001372321 | type I toxin-antitoxin system Hok family toxin | - |
RG50_RS29125 | 60736..61032 | - | 297 | Protein_76 | hypothetical protein | - |
RG50_RS26950 (RG50_25260) | 61332..61628 | + | 297 | WP_001272251 | hypothetical protein | - |
RG50_RS26955 (RG50_25265) | 61739..62560 | + | 822 | WP_001234445 | DUF932 domain-containing protein | - |
RG50_RS26960 (RG50_25270) | 62857..63459 | - | 603 | WP_000243713 | transglycosylase SLT domain-containing protein | virB1 |
RG50_RS26965 (RG50_25275) | 63782..64165 | + | 384 | WP_001354030 | conjugal transfer relaxosome DNA-binding protein TraM | - |
RG50_RS26970 (RG50_25280) | 64359..65030 | + | 672 | WP_000283561 | conjugal transfer transcriptional regulator TraJ | - |
RG50_RS26975 (RG50_25285) | 65167..65394 | + | 228 | WP_000089263 | conjugal transfer relaxosome protein TraY | - |
RG50_RS26980 (RG50_25290) | 65427..65786 | + | 360 | WP_001098992 | type IV conjugative transfer system pilin TraA | - |
RG50_RS26985 (RG50_25295) | 65801..66112 | + | 312 | WP_000012113 | type IV conjugative transfer system protein TraL | traL |
RG50_RS26990 (RG50_25300) | 66134..66700 | + | 567 | WP_000399780 | type IV conjugative transfer system protein TraE | traE |
RG50_RS26995 (RG50_25305) | 66687..67415 | + | 729 | WP_001230772 | type-F conjugative transfer system secretin TraK | traK |
RG50_RS27000 (RG50_25310) | 67415..68866 | + | 1452 | WP_000146675 | F-type conjugal transfer pilus assembly protein TraB | traB |
RG50_RS27005 (RG50_25315) | 68856..69422 | + | 567 | WP_000896599 | conjugal transfer pilus-stabilizing protein TraP | - |
RG50_RS27010 (RG50_25320) | 69409..69729 | + | 321 | WP_001057307 | conjugal transfer protein TrbD | - |
RG50_RS27015 (RG50_25325) | 69726..70241 | + | 516 | WP_000809881 | type IV conjugative transfer system lipoprotein TraV | traV |
RG50_RS27020 (RG50_25330) | 70376..70597 | + | 222 | WP_001278683 | conjugal transfer protein TraR | - |
RG50_RS27025 (RG50_25335) | 70590..71066 | + | 477 | WP_000549587 | hypothetical protein | - |
RG50_RS27030 (RG50_25340) | 71146..71364 | + | 219 | WP_000556745 | hypothetical protein | - |
RG50_RS28935 (RG50_25345) | 71392..71739 | + | 348 | WP_000836682 | hypothetical protein | - |
RG50_RS27040 (RG50_25350) | 71865..74495 | + | 2631 | WP_000069777 | type IV secretion system protein TraC | virb4 |
RG50_RS27045 (RG50_25355) | 74492..74878 | + | 387 | WP_000214084 | type-F conjugative transfer system protein TrbI | - |
RG50_RS27050 (RG50_25360) | 74875..75507 | + | 633 | WP_001203728 | type-F conjugative transfer system protein TraW | traW |
RG50_RS27055 (RG50_25365) | 75504..76496 | + | 993 | WP_000830838 | conjugal transfer pilus assembly protein TraU | traU |
RG50_RS27060 (RG50_25370) | 76526..76831 | + | 306 | WP_000224416 | hypothetical protein | - |
RG50_RS27065 (RG50_25375) | 76840..77478 | + | 639 | WP_001080256 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
RG50_RS27070 (RG50_25380) | 77475..79325 | + | 1851 | WP_000821856 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
RG50_RS27075 (RG50_25385) | 79352..79609 | + | 258 | WP_000864353 | conjugal transfer protein TrbE | - |
RG50_RS27080 (RG50_25390) | 79602..80345 | + | 744 | WP_001030371 | type-F conjugative transfer system pilin assembly protein TraF | traF |
RG50_RS27085 (RG50_25395) | 80359..80703 | + | 345 | WP_000556796 | conjugal transfer protein TrbA | - |
RG50_RS27090 (RG50_25400) | 80822..81106 | + | 285 | WP_000624194 | type-F conjugative transfer system pilin chaperone TraQ | - |
RG50_RS27095 (RG50_25405) | 81093..81638 | + | 546 | WP_000059831 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
RG50_RS27100 (RG50_25410) | 81568..81927 | + | 360 | WP_073529434 | P-type conjugative transfer protein TrbJ | - |
RG50_RS27115 (RG50_25430) | 82669..83061 | + | 393 | WP_073529438 | F-type conjugal transfer protein TrbF | - |
RG50_RS27120 (RG50_25435) | 83048..84421 | + | 1374 | WP_000944331 | conjugal transfer pilus assembly protein TraH | traH |
RG50_RS27125 (RG50_25440) | 84418..87240 | + | 2823 | WP_001007039 | conjugal transfer mating-pair stabilization protein TraG | traG |
RG50_RS27130 (RG50_25445) | 87256..87741 | + | 486 | WP_000605870 | hypothetical protein | - |
RG50_RS27135 (RG50_25450) | 87790..88521 | + | 732 | WP_000782451 | conjugal transfer complement resistance protein TraT | - |
RG50_RS27140 (RG50_25455) | 88724..89038 | + | 315 | Protein_114 | hypothetical protein | - |
RG50_RS27150 (RG50_25460) | 89102..89806 | + | 705 | WP_001067855 | IS6-like element IS26 family transposase | - |
RG50_RS27160 (RG50_25465) | 89855..90289 | + | 435 | Protein_116 | hypothetical protein | - |
RG50_RS27165 (RG50_25470) | 90340..92601 | + | 2262 | WP_046072940 | type IV conjugative transfer system coupling protein TraD | virb4 |
Host bacterium
ID | 1135 | GenBank | NZ_CP010174 |
Plasmid name | pH8-B | Incompatibility group | IncR |
Plasmid size | 106274 bp | Coordinate of oriT [Strand] | 63245..63794 [-] |
Host baterium | Escherichia coli strain H8 |
Cargo genes
Drug resistance gene | tunicamycin resistance |
Virulence gene | - |
Metal resistance gene | - |
Degradation gene | - |
Symbiosis gene | - |
Anti-CRISPR | - |