Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100668
Name   oriT_pC8-C in_silico
Organism   Escherichia coli strain C8
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP010128 (1637..1719 [+], 83 nt)
oriT length   83 nt
IRs (inverted repeats)      3..12, 16..25  (GTGTCGGGGC..GCCCTGACCC)
Location of nic site      56..57
Conserved sequence flanking the
  nic site  
 
 CTGG|CTTA
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 83 nt

>oriT_pC8-C
GGGTGTCGGGGCGCAGCCCTGACCCAGTCACGTAGCGATAGCGGAGTGTATACTGGCTTAGCCATGCGGCATCAGTGCGGATT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   740 GenBank   WP_000956000
Name   MobC_pC8-C insolico UniProt ID   _
Length   107 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 107 a.a.        Molecular weight: 11885.74 Da        Isoelectric Point: 10.8973

>WP_000956000.1 MULTISPECIES: MobC family plasmid mobilization relaxosome protein [Enterobacteriaceae]
MLTIRVTDDEHARLLERCEGKQLAVWMRRVCLGEPVARSGKLPTLAPPLLRQLAAIGNNLNQTARKVNSG
QWSSGDRVQVVAALMAIGDELRRLRLAVREQGTRDDS

  Protein domains


Predicted by InterproScan.

(50-94)


  Protein structure



No available structure.




Host bacterium


ID   1128 GenBank   NZ_CP010128
Plasmid name   pC8-C Incompatibility group   ColRNAI
Plasmid size   7982 bp Coordinate of oriT [Strand]   1637..1719 [+]
Host baterium   Escherichia coli strain C8

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -