Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100648
Name   oriT_pLA2 in_silico
Organism   Novosphingobium pentaromativorans US6-1
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP009296 (1027..1216 [-], 190 nt)
oriT length   190 nt
IRs (inverted repeats)      IR1: 19..38, 39..58  (AACCGTGAAGCGCGATCCGA..TAGGATTGAGCGTATCGGTT)
  IR2: 117..128, 131..142  (AAAGCGGTGGCA..TGCCACCGCTCT)
Location of nic site      86..87
Conserved sequence flanking the
  nic site  
 
 TATCCTG|C
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 190 nt

>oriT_pLA2
GTGGGGTAGGTATCTCCCAACCGTGAAGCGCGATCCGATAGGATTGAGCGTATCGGTTAACATTAGCCGCCGCAAGGCTTATCCTGCCATACAGTAGATACCTACCCCACAAACAAAAAGCGGTGGCAACTGCCACCGCTCTAAATTCCACGTCGCCTCGATGCTGAGAGAACGTGGACGGTAAAAGCTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   720 GenBank   WP_004213271
Name   PutativerelaxaseofpLA2 insolico UniProt ID   G6ELI0
Length   347 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 347 a.a.        Molecular weight: 38494.16 Da        Isoelectric Point: 11.3910

>WP_004213271.1 MULTISPECIES: relaxase/mobilization nuclease domain-containing protein [Sphingomonadaceae]
MSDFDSSFEAGQLAALFKPKLTSDPNRRGADMLLRSLSSRRAGQGGSTRARLARVVSRAPEVMVKVTGRP
KGKNHAAAHFDYIGRKGDVPLETRDGDILTDKEARAELARDWGDPVYWRDNSTVAAVSMVFSMPAGTDPD
KVLSAVREVARSEIGHEWDYVLALHTDTPRPHVHVTVAARGDTGQRFNPRPQTLHHYRERFAEELRARGV
TAEATPRAARGVGRAGQSMALNRMRQRYMAGTAPAPFANQKITAAARDQLAGRSTAPDFVVRGRQAWNET
QHRYLAAAKRLETSSDPADRQLADQVRQFVGAGRTPTIHERSVAAMERKRQSERSRNRDRSREGPGR

  Protein domains


Predicted by InterproScan.

(116-203)


  Protein structure


Source ID Structure
AlphaFold DB G6ELI0


T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 29159..39126

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JI59_RS25225 (JI59_26165) 25318..25548 - 231 WP_004213230 hypothetical protein -
JI59_RS25230 (JI59_26170) 25608..26057 - 450 WP_004213229 hypothetical protein -
JI59_RS25235 (JI59_26175) 26097..27275 - 1179 WP_004213228 LPD7 domain-containing protein -
JI59_RS25240 (JI59_26180) 27265..29181 - 1917 WP_004213227 type IV secretory system conjugative DNA transfer family protein -
JI59_RS25245 (JI59_26185) 29159..30151 - 993 WP_004213226 P-type DNA transfer ATPase VirB11 virB11
JI59_RS25250 (JI59_26190) 30148..31416 - 1269 WP_004213224 type IV secretion system protein VirB10 virB10
JI59_RS25255 (JI59_26195) 31418..32260 - 843 WP_004213222 TrbG/VirB9 family P-type conjugative transfer protein virB9
JI59_RS25260 (JI59_26200) 32257..32940 - 684 WP_004213217 VirB8/TrbF family protein virB8
JI59_RS25270 (JI59_26210) 33281..34297 - 1017 WP_004213214 type IV secretion system protein virB6
JI59_RS25275 (JI59_26215) 34341..34646 - 306 WP_006949657 hypothetical protein -
JI59_RS25280 (JI59_26220) 34649..35362 - 714 WP_006949655 type IV secretion system protein virB5
JI59_RS25285 (JI59_26225) 35376..37760 - 2385 WP_006949654 VirB4 family type IV secretion/conjugal transfer ATPase virb4
JI59_RS25290 (JI59_26230) 37747..38091 - 345 WP_006949650 VirB3 family type IV secretion system protein virB3
JI59_RS25295 (JI59_26235) 38098..38439 - 342 WP_004213202 TrbC/VirB2 family protein virB2
JI59_RS25300 (JI59_26240) 38461..39126 - 666 WP_004213200 lytic transglycosylase domain-containing protein virB1
JI59_RS25310 (JI59_26250) 39524..39832 - 309 WP_004213195 hypothetical protein -
JI59_RS27230 (JI59_26255) 40088..40240 + 153 WP_006949649 hypothetical protein -
JI59_RS25320 (JI59_26260) 40543..41325 + 783 WP_006949648 hypothetical protein -
JI59_RS25325 (JI59_26265) 41443..42318 + 876 WP_238532685 toprim domain-containing protein -
JI59_RS25330 (JI59_26270) 42312..42902 + 591 WP_006949646 thermonuclease family protein -
JI59_RS25335 (JI59_26275) 43019..43339 + 321 WP_006949645 hypothetical protein -


Host bacterium


ID   1108 GenBank   NZ_CP009296
Plasmid name   pLA2 Incompatibility group   _
Plasmid size   62341 bp Coordinate of oriT [Strand]   1027..1216 [-]
Host baterium   Novosphingobium pentaromativorans US6-1

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -