Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100641
Name   oriT_pCTN1046 in_silico
Organism   Ligilactobacillus salivarius strain JCM1046
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NZ_CP007650 (1792..2006 [+], 215 nt)
oriT length   215 nt
IRs (inverted repeats)      61..76, 80..95  (ACTTAACCCCCCGTAT..ACAGGGGGGTACAAAT)
  123..134, 139..150  (GAAAATCCTTTG..CAAGGGATTTAC)
Location of nic site      135..136
Conserved sequence flanking the
  nic site    		  TGG|T
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 215 nt

>oriT_pCTN1046
AAGCGGAAGTCGCAGGTGTGGACTGATCTTGCTGGCTGGTGTGGCAATAGCCACGCCAGCACTTAACCCCCCGTATCTAACAGGGGGGTACAAATCGACAGGAAACAGTCAAAAAAACATTAGAAAATCCTTTGGTTACAAGGGATTTACAAAATTTCAGCGTATGTCAAATGGGCTTTAAAAGTTGACATACGCCTTTTTGATTGGAGGGATTT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   713 GenBank   WP_000398284
Name   Relaxase_pCTN1046 insolico UniProt ID   A0A089QLZ9
Length   401 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 401 a.a.        Molecular weight: 47398.10 Da        Isoelectric Point: 6.5091

>WP_000398284.1 MULTISPECIES: MobT family relaxase [Bacteria]
MEGFLLNEQTWLQHLKEKRLAYGLSQNRLAVATGITRQYLSDIETGKVKPSEDLQQSLWEALERFNPDAP
LEMLFDYVRIRFPTTDVQQVVENILQLKLSYFLHEDYGFYSYSEHYALGDIFVLCSHELDKGVLVELKGR
GCRQFESYLLAQQRSWYEFFMDVLVAGGVMKRLDLAINDKTGILNIPVLTEKCQQEECISVFRSFKSYRS
GELVRKEEKECMGNTLYIGSLQSEVYFCIYEKDYEQYKKNDIPIEDAEVKNRFEIRLKNERAYYAVRDLL
VYDNPEHTAFKIINRYIRFVDKDDSKPRSDWKLNEEWAWFIGNNRERLKLTTKPEPYSFQRTLNWLSHQV
APTLKVAIKLDEINQTQVVKDILDHAKLTDRHKQILKQQSVKEQDVITTKK

  Protein domains


Predicted by InterproScan.

Helix-turn-helix (HTH_3)

(15-53)

Replication initiation factor (Rep_trans)

(169-373)

Rolling Circle replication initiation protein N-terminal domain (Rol_Rep_N)

(73-161)


  Protein structure


Source ID Structure
AlphaFold DB A0A089QLZ9


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 432..11097

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LSJ_RS12035 317..403 + 87 Protein_0 conjugal transfer protein -
LSJ_RS11385 (LSJ_5001) 432..1817 + 1386 WP_000813488 FtsK/SpoIIIE domain-containing protein virb4
LSJ_RS11390 1820..1972 + 153 WP_000879507 hypothetical protein -
LSJ_RS11395 (LSJ_5002) 1995..3200 + 1206 WP_000398284 MobT family relaxase -
LSJ_RS11400 (LSJ_5003) 3243..3464 + 222 WP_001009056 hypothetical protein orf19
LSJ_RS11405 (LSJ_5004) 3581..4078 + 498 WP_000342539 antirestriction protein ArdA -
LSJ_RS11410 (LSJ_5005) 4167..4559 + 393 WP_000723888 conjugal transfer protein orf17a
LSJ_RS11415 (LSJ_5006) 4543..6990 + 2448 WP_000331160 ATP-binding protein virb4
LSJ_RS11420 (LSJ_5007) 6993..9170 + 2178 WP_000804748 membrane protein orf15
LSJ_RS11425 (LSJ_5008) 9167..10168 + 1002 WP_000769868 bifunctional lysozyme/C40 family peptidase orf14
LSJ_RS11430 (LSJ_5009) 10165..11097 + 933 WP_001224318 conjugal transfer protein orf13
LSJ_RS12040 (LSJ_5010) 11342..11458 + 117 WP_001791010 tetracycline resistance determinant leader peptide -
LSJ_RS11435 (LSJ_5011) 11474..13393 + 1920 WP_002371500 tetracycline resistance ribosomal protection protein Tet(M) -
LSJ_RS12045 (LSJ_5012) 13512..13679 + 168 WP_000336323 cysteine-rich KTR domain-containing protein -
LSJ_RS11445 (LSJ_5013c) 13739..14092 - 354 WP_001227347 helix-turn-helix transcriptional regulator -
LSJ_RS11450 (LSJ_5015) 14597..15019 + 423 WP_000804885 sigma-70 family RNA polymerase sigma factor -
LSJ_RS11455 (LSJ_5016) 15016..15246 + 231 WP_000857133 helix-turn-helix domain-containing protein -
LSJ_RS12880 (LSJ_5018c) 15472..15723 - 252 WP_001845478 hypothetical protein -
LSJ_RS11460 (LSJ_5019) 15707..15910 + 204 WP_000814511 excisionase -

Host bacterium

ID   1101 GenBank   NZ_CP007650
Plasmid name   pCTN1046 Incompatibility group   _
Plasmid size   33315 bp Coordinate of oriT [Strand]   1792..2006 [+]
Host baterium   Ligilactobacillus salivarius strain JCM1046

Cargo genes

Drug resistance gene   tetracycline resistance
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -