Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100612
Name   oriT_pFI430 in_silico
Organism   Lactococcus cremoris subsp. cremoris MG1363
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NC_025249 (30906..30945 [+], 40 nt)
oriT length   40 nt
IRs (inverted repeats)      4..11, 16..23  (GTAAGATG..CATCTTAC)
Location of nic site      31..32
Conserved sequence flanking the
  nic site    		  CTTG|CA
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 40 nt

>oriT_pFI430
TCCGTAAGATGCTATCATCTTACTATGCTTGCAAAAGGTC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   684 GenBank   YP_009091785
Name   MobA_pFI430 insolico UniProt ID   W5IDF4
Length   584 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 584 a.a.        Molecular weight: 67146.02 Da        Isoelectric Point: 6.5572

>YP_009091785.1 MobA (plasmid) [Lactococcus lactis subsp. cremoris MG1363]
MVYTKHIIVHKLKHLRQAKDYVENAEKTLVNESNEDHLTNLFPYISNPDKTMSKQLVSGHGITNVYDAAN
EFIATKKLKALSKGTDFNFDPQTGKVRFNVESLEKNNAVLGHHLIQSFSPDDNLTPEQIHEIGRQTILEF
TGGEYEFVIATHVDREHIHNVRPDRVLSQVVCEQGGTSLLHHIIFNSTNLYTGKQFDWKVIPKEKTKSGK
AYDVTKNNFEKVSDKIASRYGAKIIEKSPGNSHLKYTKWQTQSIYKSQIKQRLDYLLEMSSDIEDFKRKA
TALNLSFDFSGKWTTYRLLDEPQMKNTRGRNLDKNRPEKYNLESIIERLETNELSLTVDEVVERYEEKVD
VVKQDFDYQVTVEKGQIDHMTSKGFYLNVDFGIADRGQIFIGGYKVDQLENRDCVLYLKKNETFRLLSEK
EASFTKYLTGHDLAKQLGLYNGTVPLKKEPVISTINQLVDAINFLAEHGVTEGTQFNNMESQLMSALGEA
EEKLYVIDNKIMELTKIAKLLIEKESDHSQAVINELENLGVGPSIKYQDIHQELQSEKMSRKILKNKFEQ
TVDEINTFNEIRVTTLEENKGKIL

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(34-160)

Relaxase/Mobilisation nuclease domain (Relaxase)

(182-328)


  Protein structure


Source ID Structure
AlphaFold DB W5IDF4


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 7600..23649

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HS325_RS00020 (D688_p3004) 2999..3196 + 198 WP_011835268 hypothetical protein -
HS325_RS00025 (D688_p3005) 3210..3407 + 198 WP_011835267 hypothetical protein -
HS325_RS00030 (D688_p3006) 3412..3675 + 264 WP_011835266 hypothetical protein -
HS325_RS00035 3677..3820 + 144 WP_014735049 hypothetical protein -
HS325_RS00040 3836..4081 + 246 WP_014735048 hypothetical protein -
HS325_RS00045 (D688_p3007) 4086..4625 + 540 WP_011835265 hypothetical protein -
HS325_RS00050 (D688_p3008) 5055..5417 + 363 WP_011835264 hypothetical protein -
HS325_RS00055 5572..5805 + 234 WP_014735047 hypothetical protein -
HS325_RS00060 (D688_p3009) 6051..6350 + 300 WP_011835263 DnaJ domain-containing protein -
HS325_RS00065 (D688_p3010) 6368..7390 + 1023 WP_011835262 hypothetical protein -
HS325_RS00070 (D688_p3011) 7600..11331 + 3732 WP_011835261 SspB-related isopeptide-forming adhesin prgB
HS325_RS00075 (D688_p3014) 11702..12100 + 399 WP_011835258 hypothetical protein -
HS325_RS00080 12152..12379 + 228 WP_014735045 hypothetical protein -
HS325_RS00085 (D688_p3015) 12391..13179 + 789 WP_011835257 hypothetical protein prgHb
HS325_RS00090 (D688_p3016) 13181..13534 + 354 WP_011835256 hypothetical protein prgIc
HS325_RS00095 (D688_p3017) 13488..15878 + 2391 WP_041931300 VirB4-like conjugal transfer ATPase, CD1110 family virb4
HS325_RS00100 (D688_p3018) 15882..18494 + 2613 WP_011835254 phage tail tip lysozyme prgK
HS325_RS00105 (D688_p3019) 18504..18821 + 318 WP_011835253 hypothetical protein -
HS325_RS00110 (D688_p3020) 18847..19539 + 693 WP_011835252 hypothetical protein prgL
HS325_RS00115 (D688_p3021) 19540..19785 + 246 WP_011835251 hypothetical protein -
HS325_RS00120 (D688_p3022) 19785..21098 + 1314 WP_011835250 hypothetical protein -
HS325_RS00125 (D688_p3023) 21114..21332 + 219 WP_011835249 hypothetical protein -
HS325_RS00130 (D688_p3024) 21311..21814 + 504 WP_011835248 hypothetical protein -
HS325_RS00135 (D688_p3025) 21811..23649 + 1839 WP_011835247 VirD4-like conjugal transfer protein, CD1115 family virb4
HS325_RS00140 (D688_p3026) 23675..24739 + 1065 WP_011835246 hypothetical protein -
HS325_RS00145 (D688_p3027) 24848..25042 + 195 WP_011835245 hypothetical protein -
HS325_RS00150 (D688_p3028) 25104..26288 + 1185 WP_011835244 toprim domain-containing protein -
HS325_RS00155 (D688_p3029) 26302..26817 + 516 WP_011835243 hypothetical protein -
HS325_RS00160 (D688_p3030) 26798..28564 + 1767 WP_011835242 hypothetical protein -

Host bacterium

ID   1072 GenBank   NC_025249
Plasmid name   pFI430 Incompatibility group   _
Plasmid size   59474 bp Coordinate of oriT [Strand]   30906..30945 [+]
Host baterium   Lactococcus cremoris subsp. cremoris MG1363

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -