Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100611
Name   oriT_pJIE512b in_silico
Organism   Escherichia coli
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NC_025198 (38515..38624 [-], 110 nt)
oriT length   110 nt
IRs (inverted repeats)      IR1: 24..31, 35..42  (GTCGGGGC..GCCCTGAC)
 IR2: 49..65, 72..88  (GTAATTGTAATAGCGTC..GACGGTATTACAATTAC)
Location of nic site      96..97
Conserved sequence flanking the
  nic site  
 
 CATCCTG|T
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 110 nt

>oriT_pJIE512b
TCACTTCAGGCTCCTTACGGGGTGTCGGGGCGAAGCCCTGACCAGATGGTAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTACACATCCTGTCCCGTTTTTCAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   683 GenBank   YP_009072152
Name   NikB_pJIE512b insolico UniProt ID   _
Length   899 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 103834.33 Da        Isoelectric Point: 7.3473

>YP_009072152.1 relaxase protein NikB (plasmid) [Escherichia coli]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELNLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIAQQAHYAKDNTDPVFHYILSWQAHESPRPEQIYDSVR
HTLKSLGLGEHQYVSAVHTDTDNLHVHVAVNRVHPVTGYLNCLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVHDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCQAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFLQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPESRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDKSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG

  Protein domains


Predicted by InterproScan.

(62-314)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 43984..82232

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
H4J97_RS00280 (D616_p157067) 41700..43991 - 2292 WP_072107381 F-type conjugative transfer protein TrbC -
H4J97_RS00285 (D616_p157068) 43984..45054 - 1071 WP_000151576 IncI1-type conjugal transfer protein TrbB trbB
H4J97_RS00290 (D616_p157069) 45073..46281 - 1209 WP_000121273 IncI1-type conjugal transfer protein TrbA trbA
H4J97_RS00295 (D616_p157071) 46573..46725 + 153 WP_001303307 Hok/Gef family protein -
H4J97_RS00300 (D616_p157072) 46797..47048 - 252 WP_001291967 hypothetical protein -
H4J97_RS00565 47547..47642 + 96 WP_001303310 DinQ-like type I toxin DqlB -
H4J97_RS00305 (D616_p157074) 47707..48051 - 345 WP_181394993 hypothetical protein -
H4J97_RS00310 (D616_p157075) 48226..48435 + 210 WP_000062602 HEAT repeat domain-containing protein -
H4J97_RS00315 (D616_p157076) 48507..49169 - 663 WP_032073207 plasmid IncI1-type surface exclusion protein ExcA -
H4J97_RS00320 (D616_p157077) 49234..51396 - 2163 WP_000698351 DotA/TraY family protein traY
H4J97_RS00325 (D616_p157078) 51493..52077 - 585 WP_001037985 IncI1-type conjugal transfer protein TraX -
H4J97_RS00330 (D616_p157079) 52106..53308 - 1203 WP_021555368 IncI1-type conjugal transfer protein TraW traW
H4J97_RS00335 (D616_p157080) 53275..53889 - 615 WP_001542516 IncI1-type conjugal transfer protein TraV traV
H4J97_RS00340 (D616_p157081) 53889..56933 - 3045 WP_001024779 IncI1-type conjugal transfer protein TraU traU
H4J97_RS00345 (D616_p157082) 57023..57823 - 801 WP_001164788 IncI1-type conjugal transfer protein TraT traT
H4J97_RS00350 (D616_p157083) 57807..57995 - 189 WP_001277255 putative conjugal transfer protein TraS -
H4J97_RS00355 (D616_p157084) 58059..58463 - 405 WP_000086957 IncI1-type conjugal transfer protein TraR traR
H4J97_RS00360 (D616_p157085) 58514..59041 - 528 WP_001055569 conjugal transfer protein TraQ traQ
H4J97_RS00365 (D616_p157086) 59041..59745 - 705 WP_000801920 IncI1-type conjugal transfer protein TraP traP
H4J97_RS00370 (D616_p157087) 59745..61034 - 1290 WP_001272005 conjugal transfer protein TraO traO
H4J97_RS00375 (D616_p157088) 61037..62020 - 984 WP_001191877 IncI1-type conjugal transfer protein TraN traN
H4J97_RS00380 (D616_p157089) 62031..62723 - 693 WP_000138548 DotI/IcmL family type IV secretion protein traM
H4J97_RS00385 (D616_p157090) 62720..63067 - 348 WP_001055900 conjugal transfer protein traL
H4J97_RS00390 (D616_p157091) 63085..66852 - 3768 WP_032073208 LPD7 domain-containing protein -
H4J97_RS00395 66942..67493 - 552 WP_000014583 phospholipase D family protein -
H4J97_RS00400 67508..67798 - 291 WP_001299214 hypothetical protein traK
H4J97_RS00405 (D616_p157093) 67795..68943 - 1149 WP_001024972 plasmid transfer ATPase TraJ virB11
H4J97_RS00410 (D616_p157094) 68940..69758 - 819 WP_000646098 IncI1-type conjugal transfer lipoprotein TraI traI
H4J97_RS00415 (D616_p157095) 69755..70213 - 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
H4J97_RS00420 (D616_p157096) 70608..71192 - 585 WP_000977522 histidine phosphatase family protein -
H4J97_RS00425 (D616_p157097) 71252..72454 - 1203 WP_000976351 conjugal transfer protein TraF -
H4J97_RS00430 (D616_p157098) 72539..73363 - 825 WP_001238939 conjugal transfer protein TraE traE
H4J97_RS00435 (D616_p157099) 73514..74668 - 1155 WP_001139957 site-specific integrase -
H4J97_RS00440 74652..74984 + 333 WP_094190803 shufflon protein C -
H4J97_RS00445 74981..75136 - 156 WP_001302705 hypothetical protein -
H4J97_RS00450 75797..76054 + 258 WP_001302706 hypothetical protein -
H4J97_RS00455 76189..76437 + 249 WP_001349157 hypothetical protein -
H4J97_RS00460 (D616_p157100) 76434..77726 - 1293 WP_001417545 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
H4J97_RS00465 (D616_p157101) 77726..78382 - 657 WP_001193553 prepilin peptidase -
H4J97_RS00470 (D616_p157102) 78367..78927 - 561 WP_000014116 lytic transglycosylase domain-containing protein virB1
H4J97_RS00475 (D616_p157103) 78937..79551 - 615 WP_000959785 type 4 pilus major pilin -
H4J97_RS00480 (D616_p157104) 79569..80666 - 1098 WP_001208805 type II secretion system F family protein -
H4J97_RS00485 (D616_p157105) 80679..82232 - 1554 WP_032073210 ATPase, T2SS/T4P/T4SS family virB11
H4J97_RS00490 (D616_p157106) 82243..82695 - 453 WP_001247336 type IV pilus biogenesis protein PilP -
H4J97_RS00495 (D616_p157107) 82682..83977 - 1296 WP_000752774 type 4b pilus protein PilO2 -
H4J97_RS00500 (D616_p157108) 83970..85652 - 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
H4J97_RS00505 (D616_p157109) 85666..86103 - 438 WP_000539807 type IV pilus biogenesis protein PilM -
H4J97_RS00510 (D616_p157110) 86103..87170 - 1068 WP_000742600 type IV pilus biogenesis lipoprotein PilL -


Host bacterium


ID   1071 GenBank   NC_025198
Plasmid name   pJIE512b Incompatibility group   IncI1
Plasmid size   92339 bp Coordinate of oriT [Strand]   38515..38624 [-]
Host baterium   Escherichia coli

Cargo genes


Drug resistance gene   blaCMY-2
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -