Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100605
Name   oriT_pC59-153 in_silico
Organism   Escherichia coli
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NC_025179 (109987..110276 [-], 290 nt)
oriT length   290 nt
IRs (inverted repeats)      225..232, 235..242 n  (GCAAAAAC..GTTTTTGC)
Location of nic site      251..252
Conserved sequence flanking the
  nic site    		  GTGGGGTGT|GG
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 290 nt

>oriT_pC59-153
CGCACCGCTAGCAGCGCCCCTAGCGGTATCCTATAAAAAAACACACCGCGCCGCTAGCAGCCCCCCTAATATAAAATAATGTTTTTTATAAAAATAGTCAGTACCACCCCTACAAAGCGGTGTCGGCGCGTTGTTGTAGCCTCGCCGACACCGCTTTTTTAAATATCATAAAGAGAGTAAGAGAAACTAATTTTTCATAACTCTCTATTTATAAAGAAAAATCAGCAAAAACTTGTTTTTGCGTGGGGTGTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTTGAGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   677 GenBank   YP_009071262
Name   TraI_pC59-153 insolico UniProt ID   A0A075MCD1
Length   1756 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 1756 a.a.        Molecular weight: 191983.83 Da        Isoelectric Point: 5.9594

>YP_009071262.1 IncF plasmid conjugative transfer DNA-nicking and unwinding protein TraI (plasmid) [Escherichia coli]
MMSIAQVRSAGSAGNYYTDKDNYYVLGSMGERWAGRGAEQLGLQGSVDKDVFTRLLEGKLPDGADLSRMQ
DGSNKHRPGYDLTFSAPKSVSVMAMLGGDKRLIDAHNQAVDFAVRQVEALASTRVMTDGQSETVLTGNLV
MALFNHDTSRDQEPQLHTHAVVANVTQHNGEWKTLSSDKVGKTGFIENVYANQIAFGRLYREKLKEQVEA
LGYETEVVGKHGMWEMPGVPVEAFSGRSQAIREAVGEDASLKSRDVAALDTRKSKQHVDPEVRMAEWMQT
LKETGFDIRAYRDAADQRAETRTQTPGPASQDGPDVQQAVTQAIAGLSERKVQFTYTDVLARTVGILPPE
NGVIERARAGIDEAISREQLIPLDREKGLFTSGIHVLDELSVRALSRDIMKQNRVTVHPEKSVPRTAGYS
DAVSVLAQDRPSLAIVSGQGGAAGQRERVAELVMMAREQGREVQIIAADRRSQMNLKQDERLSGELITGR
RQLQEGMAFTPGNTVIVDQGEKLSLKETLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKDAGVNTYRW
QGGEQRPATIISEPDRNVRYARLAGDFAASVKAGEESVAQVSGVREQAILTQAIRSELKTQGVLGLPEVT
MTALSPVWLDSRSRYLRDMYRPGMVMEQWNPETRSHDRYVIDRVTAQSHSLTLRDAQGETQVVRISSLDS
SWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVASVSEDAMTVVVPGRAEPASLPVSDSPFTALKL
ENGWVETPGHSVSDSAKVFASVTQMAMDNATLNGLARSGRDVRLYSSLDETRTAEKLARHPSFTVVSEQI
KARAGETLLETAISLQKAGLHTPAQQAIHLALPVLESKNLAFSMVDLLTEAKSFAAEGTSFIDLGGEINA
QIKRGDLLYVDVAKGYGTGLLVSRASYEAEKSILRHILEGKEAVTPLMERVPGELMEKLTSGQRAATRMI
LETSDRFTVVQGYAGVGKTTQFRAVMSAVNMLPESERPRVVGLGPTHRAVGEMRSAGVDAQTLASFLHDT
QLQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIAAGGGRAVASGDTDQLQAIAPGQPFRLQQTRSA
ADVAIMKEIVRQTPELREAVYSLINRDVERALSGLESVKPSQVPRQEGAWVPEHSVTEFSHSQEAKLAEA
QQKAMLKGEAFPDIPMTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIHDAREKAGELGKEQVM
VPVLNTANIRDGELRRLSTWETHRDALALVDNVYHRIAGISKDDGLITLQDAEGNTRLISPREAVAEGVT
LYTPDTIRVGTGDRMRFTKSDRECGYVANSVWTVTAVSGDSVTLSDGQQTRVIRPGQERAEQHIDLAYAI
TAHGAQGASETFAIALEGTEGNRKQMTGFESAYVALSRMKQHVQVYTDNRQGWTDAINNAVQKGTAHDVL
EPKSDREVMNAERLFSTARELRDVVAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDRNGKSAG
IWLNPLTTDDGNGLRGFSGEGRVKGSGDAQFVALQGSRNGESLLADNMQDGVRIARDNPDSGVVVRIAGE
GRPWNPRTITGGRVWGDIPDNSVQPGAGNGEPVTAEVLAQRQAEEAIRRETERRADEIVRKMAENKPDLP
DGKTEQAVRDIAGLERDRSAISEREAALPESVLREPQRVREAVREVARENLLQERLQQMERDMVRDLQKE
KTLGGD

  Protein domains


Predicted by InterproScan.

DNA relaxase TraI 2B/2B-like domain (TraI_2B)

(633-712)

AAA domain (AAA_30)

(969-1156)

TrwC relaxase (TrwC)

(10-283)

single-stranded DNA binding TraI N-terminal subdomain (ssDNA_TraI_N)

(575-625)

DNA helicase TraI (TraI_C)

(1434-1557)


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 109425..135852

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HTC56_RS00500 (D616_p153128) 105683..106117 + 435 WP_000845962 conjugation system SOS inhibitor PsiB -
HTC56_RS00505 (D616_p153129) 106114..106876 + 763 Protein_103 plasmid SOS inhibition protein A -
HTC56_RS00510 (D616_p153130) 106854..107033 - 180 WP_001334662 hypothetical protein -
HTC56_RS00830 107055..107204 + 150 Protein_105 plasmid maintenance protein Mok -
HTC56_RS00515 (D616_p153131) 107146..107271 + 126 WP_096937776 type I toxin-antitoxin system Hok family toxin -
HTC56_RS00835 107572..107845 - 274 Protein_107 hypothetical protein -
HTC56_RS00520 (D616_p153133) 107897..108193 + 297 WP_001272245 hypothetical protein -
HTC56_RS00525 (D616_p153134) 108304..109125 + 822 WP_001234487 DUF932 domain-containing protein -
HTC56_RS00530 (D616_p153136) 109425..110027 - 603 WP_000243712 transglycosylase SLT domain-containing protein virB1
HTC56_RS00535 (D616_p153137) 110348..110731 + 384 WP_001151524 conjugal transfer relaxosome DNA-binding protein TraM -
HTC56_RS00540 (D616_p153138) 110918..111607 + 690 WP_000283385 conjugal transfer transcriptional regulator TraJ -
HTC56_RS00545 (D616_p153139) 111706..112101 + 396 WP_001309237 conjugal transfer relaxosome DNA-bindin protein TraY -
HTC56_RS00550 (D616_p153140) 112134..112499 + 366 WP_000994779 type IV conjugative transfer system pilin TraA -
HTC56_RS00555 (D616_p153141) 112514..112825 + 312 WP_000012106 type IV conjugative transfer system protein TraL traL
HTC56_RS00560 (D616_p153142) 112847..113413 + 567 WP_000399792 type IV conjugative transfer system protein TraE traE
HTC56_RS00565 (D616_p153143) 113400..114128 + 729 WP_001230787 type-F conjugative transfer system secretin TraK traK
HTC56_RS00570 (D616_p153144) 114128..115555 + 1428 WP_000146685 F-type conjugal transfer pilus assembly protein TraB traB
HTC56_RS00575 (D616_p153145) 115545..116135 + 591 WP_000002787 conjugal transfer pilus-stabilizing protein TraP -
HTC56_RS00580 (D616_p153146) 116122..116319 + 198 WP_001324648 conjugal transfer protein TrbD -
HTC56_RS00585 (D616_p153147) 116331..116582 + 252 WP_001038342 conjugal transfer protein TrbG -
HTC56_RS00590 (D616_p153148) 116579..117094 + 516 WP_000809838 type IV conjugative transfer system lipoprotein TraV traV
HTC56_RS00595 (D616_p153149) 117229..117450 + 222 WP_001278689 conjugal transfer protein TraR -
HTC56_RS00600 (D616_p153151) 117610..120237 + 2628 WP_001064248 type IV secretion system protein TraC virb4
HTC56_RS00605 (D616_p153152) 120234..120620 + 387 WP_032072879 type-F conjugative transfer system protein TrbI -
HTC56_RS00610 (D616_p153153) 120617..121249 + 633 WP_032072880 type-F conjugative transfer system protein TraW traW
HTC56_RS00615 (D616_p153154) 121246..122238 + 993 WP_000830180 conjugal transfer pilus assembly protein TraU traU
HTC56_RS00620 (D616_p153155) 122247..122885 + 639 WP_000777695 type-F conjugative transfer system pilin assembly protein TrbC trbC
HTC56_RS00625 (D616_p153156) 122882..124690 + 1809 WP_000821849 type-F conjugative transfer system mating-pair stabilization protein TraN traN
HTC56_RS00630 (D616_p153157) 124717..124974 + 258 WP_000864318 conjugal transfer protein TrbE -
HTC56_RS00635 (D616_p153158) 124967..125710 + 744 WP_001030377 type-F conjugative transfer system pilin assembly protein TraF traF
HTC56_RS00640 (D616_p153159) 125726..126073 + 348 WP_001287910 conjugal transfer protein TrbA -
HTC56_RS00645 (D616_p153160) 126075..126389 - 315 WP_000415566 protein ArtA -
HTC56_RS00650 (D616_p153161) 126470..126754 + 285 WP_000624109 type-F conjugative transfer system pilin chaperone TraQ -
HTC56_RS00655 (D616_p153162) 126741..127286 + 546 WP_000059851 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
HTC56_RS00660 (D616_p153163) 127216..127557 + 342 WP_001443031 P-type conjugative transfer protein TrbJ -
HTC56_RS00665 (D616_p153164) 127544..127924 + 381 WP_001680290 F-type conjugal transfer protein TrbF -
HTC56_RS00670 (D616_p153165) 127924..129297 + 1374 WP_001517790 conjugal transfer pilus assembly protein TraH traH
HTC56_RS00675 (D616_p153166) 129294..132116 + 2823 WP_001007018 conjugal transfer mating-pair stabilization protein TraG traG
HTC56_RS00680 132132..132629 + 498 WP_000605858 hypothetical protein -
HTC56_RS00685 (D616_p153167) 132661..133392 + 732 WP_023565183 conjugal transfer complement resistance protein TraT -
HTC56_RS00690 (D616_p153169) 133645..135852 + 2208 WP_021526192 type IV conjugative transfer system coupling protein TraD virb4
HTC56_RS00695 (D616_p153170) 135861..136259 - 399 WP_000911313 type II toxin-antitoxin system VapC family toxin -
HTC56_RS00700 (D616_p153171) 136259..136486 - 228 WP_000450520 toxin-antitoxin system antitoxin VapB -

Host bacterium

ID   1065 GenBank   NC_025179
Plasmid name   pC59-153 Incompatibility group   IncFIB
Plasmid size   153231 bp Coordinate of oriT [Strand]   109987..110276 [-]
Host baterium   Escherichia coli

Cargo genes

Drug resistance gene   catA1, sitABCD
Virulence gene   iroN, iroE, iroD, iroC, iroB, iucA, iucB, iucC, iutA
Metal resistance gene   yfeC
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -