Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 100596 |
| Name | oriT_pC49-108  |
| Organism | Escherichia coli |
| Sequence Completeness | intact |
| NCBI accession of oriT (coordinates [strand]) | NC_025144 (54100..54209 [+], 110 nt) |
| oriT length | 110 nt |
| IRs (inverted repeats) | IR1: 24..31, 35..42 (GTCGGGGC..GCCCTGAC) IR2: 49..65, 72..88 (GCAATTGTAATAGCGTC..GACGGTATTACAATTGC) |
| Location of nic site | 96..97 |
| Conserved sequence flanking the nic site |
CATCCTG|T |
| Note | predicted by the oriTfinder |
oriT sequence
Download Length: 110 nt
>oriT_pC49-108
TCACTTCAGGCTCCTTACGGGGTGTCGGGGCGAAGCCCTGACCAGATGGCAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTGCACATCCTGTCCCGTTTTTCAGG
TCACTTCAGGCTCCTTACGGGGTGTCGGGGCGAAGCCCTGACCAGATGGCAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTGCACATCCTGTCCCGTTTTTCAGG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Relaxase
| ID | 668 | GenBank | YP_009069048 |
| Name | PutativerelaxaseofpC49-108 |
UniProt ID | _ |
| Length | 899 a.a. | PDB ID | |
| Note | putative relaxase | ||
Relaxase protein sequence
Download Length: 899 a.a. Molecular weight: 104010.41 Da Isoelectric Point: 7.4265
>YP_009069048.1 hypothetical protein (plasmid) [Escherichia coli]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVNDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCQAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPESRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDRSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNNDASLPPPEQDKRWEPPSPG
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVNDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCQAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPESRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDRSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNNDASLPPPEQDKRWEPPSPG
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 7762..48740
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HTE09_RS00025 (D616_p144009) | 2824..3891 | + | 1068 | WP_001302629 | type IV pilus biogenesis lipoprotein PilL | - |
| HTE09_RS00030 (D616_p144010) | 3891..4328 | + | 438 | WP_000539807 | type IV pilus biogenesis protein PilM | - |
| HTE09_RS00035 (D616_p144011) | 4342..6024 | + | 1683 | WP_000748143 | PilN family type IVB pilus formation outer membrane protein | - |
| HTE09_RS00040 (D616_p144012) | 6017..7312 | + | 1296 | WP_000752772 | type 4b pilus protein PilO2 | - |
| HTE09_RS00045 (D616_p144013) | 7299..7751 | + | 453 | WP_001247334 | type IV pilus biogenesis protein PilP | - |
| HTE09_RS00050 (D616_p144014) | 7762..9315 | + | 1554 | WP_000362202 | ATPase, T2SS/T4P/T4SS family | virB11 |
| HTE09_RS00055 (D616_p144015) | 9328..10425 | + | 1098 | WP_001208805 | type II secretion system F family protein | - |
| HTE09_RS00060 (D616_p144016) | 10443..11057 | + | 615 | WP_000959785 | type 4 pilus major pilin | - |
| HTE09_RS00065 (D616_p144017) | 11067..11627 | + | 561 | WP_000014116 | lytic transglycosylase domain-containing protein | virB1 |
| HTE09_RS00070 (D616_p144018) | 11612..12268 | + | 657 | WP_001193553 | prepilin peptidase | - |
| HTE09_RS00075 (D616_p144019) | 12268..13692 | + | 1425 | WP_001389385 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| HTE09_RS00085 (D616_p144020) | 14161..15423 | + | 1263 | WP_000608644 | IS1380-like element ISEcp1 family transposase | - |
| HTE09_RS00090 (D616_p144022) | 15711..16586 | + | 876 | WP_013188473 | extended-spectrum class A beta-lactamase CTX-M-1 | - |
| HTE09_RS00095 (D616_p144023) | 16633..16977 | - | 345 | Protein_18 | WbuC family cupin fold metalloprotein | - |
| HTE09_RS00635 | 16977..17186 | + | 210 | Protein_19 | hypothetical protein | - |
| HTE09_RS00100 | 17689..18021 | - | 333 | WP_094190803 | shufflon protein C | - |
| HTE09_RS00105 (D616_p144024) | 18005..19159 | + | 1155 | WP_001139957 | site-specific integrase | - |
| HTE09_RS00110 (D616_p144025) | 19310..20134 | + | 825 | WP_001238939 | conjugal transfer protein TraE | traE |
| HTE09_RS00115 (D616_p144026) | 20219..21421 | + | 1203 | WP_000976351 | conjugal transfer protein TraF | - |
| HTE09_RS00120 (D616_p144027) | 21481..22065 | + | 585 | WP_000977522 | histidine phosphatase family protein | - |
| HTE09_RS00125 (D616_p144029) | 22460..22918 | + | 459 | WP_001079808 | IncI1-type conjugal transfer lipoprotein TraH | - |
| HTE09_RS00130 (D616_p144030) | 22915..23733 | + | 819 | WP_000646098 | IncI1-type conjugal transfer lipoprotein TraI | traI |
| HTE09_RS00135 (D616_p144031) | 23730..24878 | + | 1149 | WP_001024972 | plasmid transfer ATPase TraJ | virB11 |
| HTE09_RS00140 (D616_p144032) | 24875..25165 | + | 291 | WP_001299214 | hypothetical protein | traK |
| HTE09_RS00145 (D616_p144033) | 25180..25731 | + | 552 | WP_000014583 | phospholipase D family protein | - |
| HTE09_RS00150 (D616_p144034) | 25820..29587 | + | 3768 | WP_001141527 | LPD7 domain-containing protein | - |
| HTE09_RS00155 (D616_p144035) | 29605..29952 | + | 348 | WP_001055900 | conjugal transfer protein | traL |
| HTE09_RS00160 (D616_p144036) | 29949..30641 | + | 693 | WP_000138550 | DotI/IcmL family type IV secretion protein | traM |
| HTE09_RS00165 (D616_p144037) | 30652..31635 | + | 984 | WP_001191877 | IncI1-type conjugal transfer protein TraN | traN |
| HTE09_RS00170 (D616_p144038) | 31638..32927 | + | 1290 | WP_001272003 | conjugal transfer protein TraO | traO |
| HTE09_RS00175 (D616_p144039) | 32927..33631 | + | 705 | WP_000801920 | IncI1-type conjugal transfer protein TraP | traP |
| HTE09_RS00180 (D616_p144040) | 33631..34158 | + | 528 | WP_001055569 | conjugal transfer protein TraQ | traQ |
| HTE09_RS00185 (D616_p144041) | 34209..34613 | + | 405 | WP_000086958 | IncI1-type conjugal transfer protein TraR | traR |
| HTE09_RS00190 (D616_p144042) | 34677..34865 | + | 189 | WP_001277255 | putative conjugal transfer protein TraS | - |
| HTE09_RS00195 (D616_p144043) | 34849..35649 | + | 801 | WP_001164788 | IncI1-type conjugal transfer protein TraT | traT |
| HTE09_RS00200 (D616_p144044) | 35739..38783 | + | 3045 | WP_021265678 | IncI1-type conjugal transfer protein TraU | traU |
| HTE09_RS00205 (D616_p144045) | 38783..39397 | + | 615 | WP_000337398 | IncI1-type conjugal transfer protein TraV | traV |
| HTE09_RS00210 (D616_p144046) | 39364..40566 | + | 1203 | WP_001189160 | IncI1-type conjugal transfer protein TraW | traW |
| HTE09_RS00215 (D616_p144047) | 40595..41179 | + | 585 | WP_001037987 | IncI1-type conjugal transfer protein TraX | - |
| HTE09_RS00220 (D616_p144048) | 41276..43444 | + | 2169 | WP_021537350 | DotA/TraY family protein | traY |
| HTE09_RS00225 (D616_p144049) | 43494..44168 | + | 675 | WP_223866377 | plasmid IncI1-type surface exclusion protein ExcA | - |
| HTE09_RS00230 (D616_p144050) | 44240..44449 | - | 210 | WP_000062603 | HEAT repeat domain-containing protein | - |
| HTE09_RS00620 | 44841..45017 | + | 177 | WP_001054904 | hypothetical protein | - |
| HTE09_RS00650 | 45082..45177 | - | 96 | WP_001303310 | DinQ-like type I toxin DqlB | - |
| HTE09_RS00240 (D616_p144053) | 45676..45927 | + | 252 | WP_001291964 | hypothetical protein | - |
| HTE09_RS00245 | 45999..46151 | - | 153 | WP_001331364 | Hok/Gef family protein | - |
| HTE09_RS00250 (D616_p144054) | 46443..47651 | + | 1209 | WP_000121273 | IncI1-type conjugal transfer protein TrbA | trbA |
| HTE09_RS00255 (D616_p144055) | 47670..48740 | + | 1071 | WP_000151583 | IncI1-type conjugal transfer protein TrbB | trbB |
| HTE09_RS00260 (D616_p144056) | 48733..51024 | + | 2292 | WP_001289276 | F-type conjugative transfer protein TrbC | - |
Host bacterium
| ID | 1056 | GenBank | NC_025144 |
| Plasmid name | pC49-108 | Incompatibility group | IncI1 |
| Plasmid size | 108660 bp | Coordinate of oriT [Strand] | 54100..54209 [+] |
| Host baterium | Escherichia coli |
Cargo genes
| Drug resistance gene | blaCTX-M-1, sul2, aadA5, dfrA17 |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |