Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100595
Name   oriT_pC59-112 in_silico
Organism   Escherichia coli
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NC_025143 (76579..76688 [+], 110 nt)
oriT length   110 nt
IRs (inverted repeats)      IR1: 24..31, 35..42  (GTCGGGGC..GCCCTGAC)
 IR2: 49..65, 72..88  (GCAATTGTAATAGCGTC..GACGGTATTACAATTGC)
Location of nic site      96..97
Conserved sequence flanking the
  nic site  
 
 CATCCTG|T
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 110 nt

>oriT_pC59-112
TCACTTCAGGCTCCTTACGGGGTGTCGGGGCGAAGCCCTGACCAGATGGCAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTGCACATCCTGTCCCGTTTTTCAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   667 GenBank   YP_009068927
Name   PutativerelaxaseofpC59-112 insolico UniProt ID   _
Length   899 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 104010.41 Da        Isoelectric Point: 7.4265

>YP_009068927.1 hypothetical protein (plasmid) [Escherichia coli]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVNDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCQAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPESRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDRSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNNDASLPPPEQDKRWEPPSPG

  Protein domains


Predicted by InterproScan.

(62-314)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 30241..71219

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HTD46_RS00165 (D616_p143038) 25303..26370 + 1068 WP_001302629 type IV pilus biogenesis lipoprotein PilL -
HTD46_RS00170 (D616_p143039) 26370..26807 + 438 WP_000539807 type IV pilus biogenesis protein PilM -
HTD46_RS00175 (D616_p143040) 26821..28503 + 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
HTD46_RS00180 (D616_p143041) 28496..29791 + 1296 WP_000752772 type 4b pilus protein PilO2 -
HTD46_RS00185 (D616_p143042) 29778..30230 + 453 WP_001247334 type IV pilus biogenesis protein PilP -
HTD46_RS00190 (D616_p143043) 30241..31794 + 1554 WP_000362202 ATPase, T2SS/T4P/T4SS family virB11
HTD46_RS00195 (D616_p143044) 31807..32904 + 1098 WP_001208805 type II secretion system F family protein -
HTD46_RS00200 (D616_p143045) 32922..33536 + 615 WP_000959785 type 4 pilus major pilin -
HTD46_RS00205 33546..34106 + 561 WP_000014116 lytic transglycosylase domain-containing protein virB1
HTD46_RS00210 (D616_p143047) 34091..34747 + 657 WP_001193553 prepilin peptidase -
HTD46_RS00215 (D616_p143048) 34747..36081 + 1335 WP_024132209 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
HTD46_RS00650 36083..36292 - 210 Protein_41 hypothetical protein -
HTD46_RS00220 (D616_p143049) 36292..36636 + 345 Protein_42 WbuC family cupin fold metalloprotein -
HTD46_RS00225 (D616_p143050) 36683..37558 - 876 WP_013188473 extended-spectrum class A beta-lactamase CTX-M-1 -
HTD46_RS00230 (D616_p143052) 37846..39108 - 1263 WP_000608644 IS1380-like element ISEcp1 family transposase -
HTD46_RS00640 39577..39825 - 249 WP_001349157 hypothetical protein -
HTD46_RS00240 40168..40500 - 333 WP_094190803 shufflon protein C -
HTD46_RS00245 (D616_p143054) 40484..41638 + 1155 WP_001139957 site-specific integrase -
HTD46_RS00250 (D616_p143055) 41789..42613 + 825 WP_001238939 conjugal transfer protein TraE traE
HTD46_RS00255 (D616_p143056) 42698..43900 + 1203 WP_000976351 conjugal transfer protein TraF -
HTD46_RS00260 (D616_p143057) 43960..44544 + 585 WP_000977522 histidine phosphatase family protein -
HTD46_RS00265 (D616_p143058) 44939..45397 + 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
HTD46_RS00270 (D616_p143059) 45394..46212 + 819 WP_000646098 IncI1-type conjugal transfer lipoprotein TraI traI
HTD46_RS00275 (D616_p143060) 46209..47357 + 1149 WP_001024972 plasmid transfer ATPase TraJ virB11
HTD46_RS00280 (D616_p143061) 47354..47644 + 291 WP_001299214 hypothetical protein traK
HTD46_RS00285 (D616_p143062) 47659..48210 + 552 WP_000014583 phospholipase D family protein -
HTD46_RS00290 (D616_p143063) 48299..52066 + 3768 WP_001141527 LPD7 domain-containing protein -
HTD46_RS00295 (D616_p143064) 52084..52431 + 348 WP_001055900 conjugal transfer protein traL
HTD46_RS00300 (D616_p143065) 52428..53120 + 693 WP_000138550 DotI/IcmL family type IV secretion protein traM
HTD46_RS00305 (D616_p143066) 53131..54114 + 984 WP_001191877 IncI1-type conjugal transfer protein TraN traN
HTD46_RS00310 (D616_p143067) 54117..55406 + 1290 WP_001272003 conjugal transfer protein TraO traO
HTD46_RS00315 (D616_p143068) 55406..56110 + 705 WP_000801920 IncI1-type conjugal transfer protein TraP traP
HTD46_RS00320 (D616_p143069) 56110..56637 + 528 WP_001055569 conjugal transfer protein TraQ traQ
HTD46_RS00325 (D616_p143070) 56688..57092 + 405 WP_000086958 IncI1-type conjugal transfer protein TraR traR
HTD46_RS00330 (D616_p143071) 57156..57344 + 189 WP_001277255 putative conjugal transfer protein TraS -
HTD46_RS00335 (D616_p143072) 57328..58128 + 801 WP_001164788 IncI1-type conjugal transfer protein TraT traT
HTD46_RS00340 (D616_p143073) 58218..61262 + 3045 WP_021265678 IncI1-type conjugal transfer protein TraU traU
HTD46_RS00345 (D616_p143074) 61262..61876 + 615 WP_000337398 IncI1-type conjugal transfer protein TraV traV
HTD46_RS00350 (D616_p143075) 61843..63045 + 1203 WP_001189160 IncI1-type conjugal transfer protein TraW traW
HTD46_RS00355 (D616_p143076) 63074..63658 + 585 WP_001037987 IncI1-type conjugal transfer protein TraX -
HTD46_RS00360 (D616_p143077) 63755..65923 + 2169 WP_021537350 DotA/TraY family protein traY
HTD46_RS00365 (D616_p143078) 65973..66647 + 675 WP_223866377 plasmid IncI1-type surface exclusion protein ExcA -
HTD46_RS00370 (D616_p143079) 66719..66928 - 210 WP_000062603 HEAT repeat domain-containing protein -
HTD46_RS00375 67212..67496 + 285 WP_031942457 hypothetical protein -
HTD46_RS00660 67561..67656 - 96 WP_001303310 DinQ-like type I toxin DqlB -
HTD46_RS00380 (D616_p143082) 68155..68406 + 252 WP_001291964 hypothetical protein -
HTD46_RS00385 (D616_p143083) 68478..68630 - 153 WP_001331364 Hok/Gef family protein -
HTD46_RS00390 (D616_p143084) 68922..70130 + 1209 WP_000121273 IncI1-type conjugal transfer protein TrbA trbA
HTD46_RS00395 (D616_p143085) 70149..71219 + 1071 WP_000151583 IncI1-type conjugal transfer protein TrbB trbB
HTD46_RS00400 (D616_p143086) 71212..73503 + 2292 WP_001289276 F-type conjugative transfer protein TrbC -


Host bacterium


ID   1055 GenBank   NC_025143
Plasmid name   pC59-112 Incompatibility group   IncI1
Plasmid size   112330 bp Coordinate of oriT [Strand]   76579..76688 [+]
Host baterium   Escherichia coli

Cargo genes


Drug resistance gene   sul2, aadA5, dfrA17, blaCTX-M-1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -