Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100590
Name   oriT_pFOX-7a in_silico
Organism   Klebsiella pneumoniae
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NC_025134 (30590..30695 [+], 106 nt)
oriT length   106 nt
IRs (inverted repeats)      18..35, 41..58  (GTTTTTGGAGTACCGCCG..CGGCGGCCGTCCAAAAAC)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 106 nt

>oriT_pFOX-7a
AGATAGCTAACCTCGTTAGGGGGTGTCGGGGCTTGCCCTGACCAAGACGTTTTTGGACGGCCGCCGCGTGTCGGCGGTACTCCAAAAACACATCTTGTCCCGTACT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   662 GenBank   YP_009067888
Name   MobA_pFOX-7a insolico UniProt ID   _
Length   659 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75179.89 Da        Isoelectric Point: 9.9948

>YP_009067888.1 MobA (plasmid) [Klebsiella pneumoniae]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFADIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQFRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

(86-334)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 8638..27794

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HXG90_RS00020 (D647_p51005) 4174..4731 - 558 WP_001217881 recombinase family protein -
HXG90_RS00025 (D647_p51006) 4893..7898 + 3006 WP_176455437 Tn3-like element Tn3 family transposase -
HXG90_RS00030 (D647_p51007) 7982..8635 - 654 WP_004206935 hypothetical protein -
HXG90_RS00035 (D647_p51008) 8638..10818 - 2181 WP_004187492 DotA/TraY family protein traY
HXG90_RS00040 (D647_p51009) 10811..11461 - 651 WP_004187488 hypothetical protein -
HXG90_RS00045 (D647_p51010) 11458..12666 - 1209 WP_004187486 conjugal transfer protein TraW traW
HXG90_RS00050 (D647_p51011) 12663..15713 - 3051 WP_011154474 conjugative transfer protein traU
HXG90_RS00055 15710..16204 - 495 WP_004187480 hypothetical protein -
HXG90_RS00060 (D647_p51012) 16250..16639 - 390 WP_011154472 DUF6750 family protein traR
HXG90_RS00065 (D647_p51013) 16656..17186 - 531 WP_004187478 conjugal transfer protein TraQ traQ
HXG90_RS00070 (D647_p51014) 17210..17914 - 705 WP_004206933 conjugal transfer protein TraP traP
HXG90_RS00075 (D647_p51015) 17926..19275 - 1350 WP_032072103 conjugal transfer protein TraO traO
HXG90_RS00080 (D647_p51016) 19287..20438 - 1152 WP_015062843 DotH/IcmK family type IV secretion protein traN
HXG90_RS00085 (D647_p51017) 20447..21229 - 783 WP_004206929 DotI/IcmL family type IV secretion protein traM
HXG90_RS00090 21228..21638 + 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
HXG90_RS00095 21625..21822 + 198 WP_004187464 Hha/YmoA family nucleoid-associated regulatory protein -
HXG90_RS00100 (D647_p51018) 21823..22335 - 513 WP_011091071 hypothetical protein traL
HXG90_RS00105 (D647_p51019) 22301..23980 - 1680 WP_032072104 LPD7 domain-containing protein -
HXG90_RS00110 23977..25566 - 1590 WP_176455438 toprim domain-containing protein -
HXG90_RS00115 (D647_p51020) 25591..25851 - 261 WP_004187310 IcmT/TraK family protein traK
HXG90_RS00120 (D647_p51021) 25841..27004 - 1164 WP_004187313 plasmid transfer ATPase TraJ virB11
HXG90_RS00125 (D647_p51022) 27015..27794 - 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
HXG90_RS00130 (D647_p51023) 27791..28291 - 501 WP_004187320 DotD/TraH family lipoprotein -
HXG90_RS00135 (D647_p51024) 28305..30284 - 1980 WP_004187323 TraI/MobA(P) family conjugative relaxase -
HXG90_RS00555 30271..30834 - 564 WP_020277892 plasmid mobilization protein MobA -
HXG90_RS00145 (D647_p51026) 30833..31228 + 396 WP_019725163 hypothetical protein -
HXG90_RS00150 31730..32266 - 537 WP_004187332 hypothetical protein -
HXG90_RS00155 32399..32710 - 312 WP_004187333 hypothetical protein -


Host bacterium


ID   1050 GenBank   NC_025134
Plasmid name   pFOX-7a Incompatibility group   IncL/M
Plasmid size   90439 bp Coordinate of oriT [Strand]   30590..30695 [+]
Host baterium   Klebsiella pneumoniae

Cargo genes


Drug resistance gene   blaTEM-1A, aac(6')-Ib, blaFOX-7, qacE, sul1
Virulence gene   -
Metal resistance gene   merE, merD, merA, merC, merP, merT, merR
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIIA8