Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100589
Name   oriT_pPBA in_silico
Organism   Sphingobium wenxiniae
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NC_025133 (57279..57466 [-], 188 nt)
oriT length   188 nt
IRs (inverted repeats)      IR1: 17..36, 37..56  (AACCGTGAAGCGCGATCCAA..TGGGATTGAGCGTAACGGTT)
  IR2: 115..126, 129..140  (AAAGCGGTGGCA..TGCCACCGCTCT)
Location of nic site      84..86
Conserved sequence flanking the
  nic site  
 
 TATCCTG|C
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 188 nt

>oriT_pPBA
GGGGTAGGTATCTCCCAACCGTGAAGCGCGATCCAATGGGATTGAGCGTAACGGTTAACATTAGCCGCCGCAAGGCTTATCCTGCCATACAGTAGATACCTACCCCACAAACAAAAAGCGGTGGCAACTGCCACCGCTCTAAATTCCACATCGCCTCGATGCTGAGTGAACGTGGACGGTAAAAGCTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   661 GenBank   YP_009067864
Name   MobA/VirD2_pPBA insolico UniProt ID   A0A059U2Z1
Length   347 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 347 a.a.        Molecular weight: 38679.28 Da        Isoelectric Point: 11.2122

>YP_009067864.1 endonuclease relaxase MobA/VirD2 (plasmid) [Sphingobium wenxiniae]
MSDFDSSFEAGQLAALFKPKLTSDPNRRGADMLLRSLSSRRAGQGGSTRARLARVVSRAPEVMVKVTGRP
KGKNHAAAHFDYIGRKGDVPLETRDGDILTDKEDRAELARDWGDPVYWRDNSTVAAVSMVFSMPSGTDPD
KVLSAVREVARSEIGHEWDYVLALHTDTPRPHVHVTVAARGDTGRRFNPRPQTLHHYRERFAEELRARGV
TAEATPRAARGVGRAGQSMALNRMRQRYMAGTAPAPFANQKITSAARDQLAGRSTAPDFVVRGRQAWNET
HRRYLAAAKRLEASSDPADRQLADQVREFVGAGRTPTIHERSVAAIERKRQNERSRDRDRSREGPER

  Protein domains


Predicted by InterproScan.

(75-203)


  Protein structure


Source ID Structure
AlphaFold DB A0A059U2Z1


T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 23479..33452

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HTC33_RS00115 19269..20033 - 765 WP_172685733 IS6-like element IS6100 family transposase -
HTC33_RS00120 19999..20340 - 342 WP_238839197 hypothetical protein -
HTC33_RS00125 20417..21595 - 1179 WP_031293106 LPD7 domain-containing protein -
HTC33_RS00130 (MA31_p15) 21585..23501 - 1917 WP_021223054 type IV secretory system conjugative DNA transfer family protein -
HTC33_RS00135 (MA31_p16) 23479..24471 - 993 WP_011627746 P-type DNA transfer ATPase VirB11 virB11
HTC33_RS00140 (MA31_p17) 24468..25736 - 1269 WP_021223055 type IV secretion system protein VirB10 virB10
HTC33_RS00145 (MA31_p18) 25738..26580 - 843 WP_021223056 TrbG/VirB9 family P-type conjugative transfer protein virB9
HTC33_RS00150 (MA31_p19) 26577..27260 - 684 WP_004213217 VirB8/TrbF family protein virB8
HTC33_RS00155 27270..27590 - 321 WP_021223057 hypothetical protein -
HTC33_RS00160 (MA31_p20) 27601..28617 - 1017 WP_056379780 type IV secretion system protein virB6
HTC33_RS00165 28658..28954 - 297 WP_238839198 hypothetical protein -
HTC33_RS00170 (MA31_p21) 28966..29679 - 714 WP_021223006 type IV secretion system protein virB5
HTC33_RS00175 (MA31_p22) 29693..32077 - 2385 WP_021223007 VirB4 family type IV secretion/conjugal transfer ATPase virb4
HTC33_RS00180 (MA31_p23) 32064..32408 - 345 WP_006949650 VirB3 family type IV secretion system protein virB3
HTC33_RS00185 (MA31_p24) 32415..32756 - 342 WP_004213202 TrbC/VirB2 family protein virB2
HTC33_RS00190 (MA31_p25) 32778..33452 - 675 WP_021223008 transglycosylase SLT domain-containing protein virB1
HTC33_RS00195 33467..33808 - 342 WP_007016057 hypothetical protein -
HTC33_RS00200 33850..34158 - 309 WP_004213195 hypothetical protein -
HTC33_RS00205 34318..34566 + 249 WP_007016056 hypothetical protein -
HTC33_RS00210 34869..35651 + 783 WP_092960426 replication initiation protein -
HTC33_RS00215 (MA31_p26) 35763..36644 + 882 WP_007016055 toprim domain-containing protein -
HTC33_RS00220 (MA31_p27) 36638..37228 + 591 WP_020819817 thermonuclease family protein -
HTC33_RS00225 37345..37665 + 321 WP_006949645 hypothetical protein -


Host bacterium


ID   1049 GenBank   NC_025133
Plasmid name   pPBA Incompatibility group   _
Plasmid size   59859 bp Coordinate of oriT [Strand]   57279..57466 [-]
Host baterium   Sphingobium wenxiniae

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -