Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100578
Name   oriT_pESBL-315 in_silico
Organism   Escherichia coli
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NC_024980 (45045..45154 [-], 110 nt)
oriT length   110 nt
IRs (inverted repeats)      IR1: 24..31, 35..42  (GTCGGGGC..GCCCTGAC)
 IR2: 49..65, 72..88  (GCAATTGTAATAGCGTC..GACGGTATTACAATTGC)
Location of nic site      96..97
Conserved sequence flanking the
  nic site  
 
 CATCCTG|T
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 110 nt

>oriT_pESBL-315
TCACTTCAGGCTCCTTACGGGGTGTCGGGGCGAAGCCCTGACCAGATGGCAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTGCACATCCTGTCCCGTTTTTCAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   650 GenBank   YP_009061728
Name   NikB_pESBL-315 insolico UniProt ID   A0A075URU2
Length   623 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 623 a.a.        Molecular weight: 72279.04 Da        Isoelectric Point: 7.6958

>YP_009061728.1 NikB (plasmid) [Escherichia coli]
MDGKFLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKI
AETESLQQYACRHLGERLPEMAREGRLENCQAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVW
SLLTLDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKES
LWGYSISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLG
RAEPQAGPFVSAPADLFDRVQPESRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWRE
QWRKPDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADG
KWYPPSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDRSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQ
KNGSVRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAE
MVAWHNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB A0A075URU2


T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 50512..82966

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HS311_RS00295 (D616_p130066) 48229..50519 - 2291 Protein_56 F-type conjugative transfer protein TrbC -
HS311_RS00300 (D616_p130067) 50512..51582 - 1071 WP_000151582 IncI1-type conjugal transfer protein TrbB trbB
HS311_RS00305 (D616_p130068) 51601..52809 - 1209 WP_000121273 IncI1-type conjugal transfer protein TrbA trbA
HS311_RS00310 (D616_p130069) 53116..53895 - 780 WP_275450201 protein FinQ -
HS311_RS00315 (D616_p130070) 54522..54674 + 153 WP_001303307 Hok/Gef family protein -
HS311_RS00320 (D616_p130071) 54746..54997 - 252 WP_001291965 hypothetical protein -
HS311_RS00325 55040..55204 + 165 WP_001323923 hypothetical protein -
HS311_RS00330 (D616_p130072) 55920..56204 - 285 WP_014640317 hypothetical protein -
HS311_RS00335 56305..56514 - 210 Protein_64 hemolysin expression modulator Hha -
HS311_RS00340 (D616_p130073) 56612..57226 - 615 WP_000578649 plasmid IncI1-type surface exclusion protein ExcA -
HS311_RS00345 (D616_p130074) 57302..59470 - 2169 WP_000698360 IncI1-type conjugal transfer membrane protein TraY traY
HS311_RS00350 (D616_p130075) 59567..60151 - 585 WP_001037987 IncI1-type conjugal transfer protein TraX -
HS311_RS00355 (D616_p130076) 60180..61382 - 1203 WP_001189159 IncI1-type conjugal transfer protein TraW traW
HS311_RS00360 (D616_p130077) 61349..61963 - 615 WP_000337394 IncI1-type conjugal transfer protein TraV traV
HS311_RS00365 (D616_p130078) 61963..65007 - 3045 WP_001024752 IncI1-type conjugal transfer protein TraU traU
HS311_RS00370 (D616_p130079) 65097..65897 - 801 WP_001164788 IncI1-type conjugal transfer protein TraT traT
HS311_RS00375 (D616_p130080) 65881..66069 - 189 WP_001277255 putative conjugal transfer protein TraS -
HS311_RS00380 (D616_p130081) 66133..66537 - 405 WP_000086960 IncI1-type conjugal transfer protein TraR traR
HS311_RS00385 (D616_p130082) 66588..67115 - 528 WP_001055569 conjugal transfer protein TraQ traQ
HS311_RS00390 (D616_p130083) 67115..67818 - 704 Protein_75 IncI1-type conjugal transfer protein TraP -
HS311_RS00395 67818..68519 - 702 Protein_76 conjugal transfer protein TraO -
HS311_RS00400 (D616_p130084) 68570..68860 - 291 WP_001299214 hypothetical protein traK
HS311_RS00405 (D616_p130085) 68857..70005 - 1149 WP_001024972 plasmid transfer ATPase TraJ virB11
HS311_RS00410 (D616_p130086) 70002..70820 - 819 WP_025492003 IncI1-type conjugal transfer lipoprotein TraI traI
HS311_RS00415 (D616_p130087) 70817..71275 - 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
HS311_RS00420 (D616_p130088) 71670..72254 - 585 WP_000977522 histidine phosphatase family protein -
HS311_RS00425 (D616_p130089) 72314..73516 - 1203 WP_000976349 conjugal transfer protein TraF -
HS311_RS00430 (D616_p130090) 73602..74426 - 825 WP_001238927 conjugal transfer protein TraE traE
HS311_RS00435 (D616_p130091) 74577..75731 - 1155 WP_001139958 site-specific integrase -
HS311_RS00440 76044..76199 - 156 WP_071790560 shufflon protein C' -
HS311_RS00445 (D616_p130094) 76923..77171 + 249 WP_001349157 hypothetical protein -
HS311_RS00450 (D616_p130095) 77168..78460 - 1293 WP_024198499 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
HS311_RS00455 (D616_p130096) 78460..79116 - 657 WP_001389386 prepilin peptidase -
HS311_RS00460 (D616_p130097) 79101..79661 - 561 WP_000014116 lytic transglycosylase domain-containing protein virB1
HS311_RS00465 (D616_p130098) 79671..80285 - 615 WP_000959786 type 4 pilus major pilin -
HS311_RS00470 (D616_p130099) 80303..81400 - 1098 WP_001208805 type II secretion system F family protein -
HS311_RS00475 (D616_p130100) 81413..82966 - 1554 WP_025492055 ATPase, T2SS/T4P/T4SS family virB11
HS311_RS00480 (D616_p130101) 82977..83429 - 453 WP_001247334 type IV pilus biogenesis protein PilP -
HS311_RS00485 (D616_p130102) 83416..84711 - 1296 WP_000752772 type 4b pilus protein PilO2 -
HS311_RS00490 (D616_p130103) 84704..86386 - 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
HS311_RS00495 (D616_p130104) 86400..86837 - 438 WP_000539807 type IV pilus biogenesis protein PilM -
HS311_RS00500 (D616_p130105) 86837..87903 - 1067 Protein_97 type IV pilus biogenesis lipoprotein PilL -


Host bacterium


ID   1038 GenBank   NC_024980
Plasmid name   pESBL-315 Incompatibility group   IncI1
Plasmid size   93037 bp Coordinate of oriT [Strand]   45045..45154 [-]
Host baterium   Escherichia coli

Cargo genes


Drug resistance gene   sul2, blaCTX-M-1, sul1, qacE, ant(3'')-Ia, dfrA1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrVA2