Detailed information of oriT
oriT
The information of the oriT region
oriTDB ID | 100577 |
Name | oriT_pESBL-305 |
Organism | Escherichia coli |
Sequence Completeness | intact |
NCBI accession of oriT (coordinates [strand]) | NC_024979 (53207..53316 [-], 110 nt) |
oriT length | 110 nt |
IRs (inverted repeats) | IR1: 24..31, 35..42 (GTCGGGGC..GCCCTGAC) IR2: 49..65, 72..88 (GCAATTGTAATAGCGTC..GACGGTATTACAATTGC) |
Location of nic site | 96..97 |
Conserved sequence flanking the nic site |
CATCCTG|T |
Note | predicted by the oriTfinder |
oriT sequence
Download Length: 110 nt
>oriT_pESBL-305
TCACTTCAGGCTCCTTACGGGGTGTCGGGGCGAAGCCCTGACCAGATGGCAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTGCACATCCTGTCCCGTTTTTCAGG
TCACTTCAGGCTCCTTACGGGGTGTCGGGGCGAAGCCCTGACCAGATGGCAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTGCACATCCTGTCCCGTTTTTCAGG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure fileRelaxase
ID | 649 | GenBank | YP_009061609 |
Name | NikB_pESBL-305 | UniProt ID | _ |
Length | 899 a.a. | PDB ID | |
Note | putative relaxase |
Relaxase protein sequence
Download Length: 899 a.a. Molecular weight: 104010.41 Da Isoelectric Point: 7.4265
>YP_009061609.1 NikB (plasmid) [Escherichia coli]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVNDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCQAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPESRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDRSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNNDASLPPPEQDKRWEPPSPG
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVNDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCQAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPESRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDRSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNNDASLPPPEQDKRWEPPSPG
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 58676..97480
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HS364_RS00355 (D616_p129075) | 56392..58683 | - | 2292 | WP_001289276 | F-type conjugative transfer protein TrbC | - |
HS364_RS00360 (D616_p129076) | 58676..59746 | - | 1071 | WP_000151583 | IncI1-type conjugal transfer protein TrbB | trbB |
HS364_RS00365 (D616_p129077) | 59765..60973 | - | 1209 | WP_000121273 | IncI1-type conjugal transfer protein TrbA | trbA |
HS364_RS00370 (D616_p129078) | 61265..61417 | + | 153 | WP_001331364 | Hok/Gef family protein | - |
HS364_RS00375 (D616_p129079) | 61489..61740 | - | 252 | WP_001291964 | hypothetical protein | - |
HS364_RS00635 | 62238..62333 | + | 96 | WP_001303310 | DinQ-like type I toxin DqlB | - |
HS364_RS00380 | 62398..62574 | - | 177 | WP_001054904 | hypothetical protein | - |
HS364_RS00385 (D616_p129082) | 62966..63175 | + | 210 | WP_000062603 | HEAT repeat domain-containing protein | - |
HS364_RS00390 (D616_p129083) | 63247..63921 | - | 675 | WP_223866377 | plasmid IncI1-type surface exclusion protein ExcA | - |
HS364_RS00395 (D616_p129084) | 63971..65878 | - | 1908 | WP_031942458 | conjugal transfer protein TraW | traY |
HS364_RS00400 (D616_p129085) | 65845..66459 | - | 615 | WP_000337398 | IncI1-type conjugal transfer protein TraV | traV |
HS364_RS00405 (D616_p129086) | 66459..69503 | - | 3045 | WP_021265678 | IncI1-type conjugal transfer protein TraU | traU |
HS364_RS00410 (D616_p129087) | 69593..70393 | - | 801 | WP_001164788 | IncI1-type conjugal transfer protein TraT | traT |
HS364_RS00415 (D616_p129088) | 70377..70565 | - | 189 | WP_001277255 | putative conjugal transfer protein TraS | - |
HS364_RS00420 (D616_p129089) | 70629..71033 | - | 405 | WP_000086958 | IncI1-type conjugal transfer protein TraR | traR |
HS364_RS00425 (D616_p129090) | 71084..71611 | - | 528 | WP_001055569 | conjugal transfer protein TraQ | traQ |
HS364_RS00430 (D616_p129091) | 71611..72315 | - | 705 | WP_000801920 | IncI1-type conjugal transfer protein TraP | traP |
HS364_RS00435 (D616_p129092) | 72315..73604 | - | 1290 | WP_001272003 | conjugal transfer protein TraO | traO |
HS364_RS00440 (D616_p129093) | 73607..74590 | - | 984 | WP_001191877 | IncI1-type conjugal transfer protein TraN | traN |
HS364_RS00445 (D616_p129094) | 74601..75293 | - | 693 | WP_000138550 | DotI/IcmL family type IV secretion protein | traM |
HS364_RS00450 (D616_p129095) | 75290..75637 | - | 348 | WP_001055900 | conjugal transfer protein | traL |
HS364_RS00455 (D616_p129096) | 75655..79422 | - | 3768 | WP_001141527 | LPD7 domain-containing protein | - |
HS364_RS00460 (D616_p129097) | 79511..80062 | - | 552 | WP_000014583 | phospholipase D family protein | - |
HS364_RS00465 (D616_p129098) | 80077..80367 | - | 291 | WP_001299214 | hypothetical protein | traK |
HS364_RS00470 (D616_p129099) | 80364..81512 | - | 1149 | WP_001024972 | plasmid transfer ATPase TraJ | virB11 |
HS364_RS00475 (D616_p129100) | 81509..82327 | - | 819 | WP_000646098 | IncI1-type conjugal transfer lipoprotein TraI | traI |
HS364_RS00480 (D616_p129101) | 82324..82782 | - | 459 | WP_001079808 | IncI1-type conjugal transfer lipoprotein TraH | - |
HS364_RS00485 (D616_p129102) | 83177..83761 | - | 585 | WP_000977522 | histidine phosphatase family protein | - |
HS364_RS00490 (D616_p129103) | 83821..85023 | - | 1203 | WP_000976351 | conjugal transfer protein TraF | - |
HS364_RS00495 (D616_p129104) | 85108..85932 | - | 825 | WP_001238939 | conjugal transfer protein TraE | traE |
HS364_RS00500 (D616_p129105) | 86083..87237 | - | 1155 | WP_001139957 | site-specific integrase | - |
HS364_RS00505 (D616_p129106) | 87221..87553 | + | 333 | WP_094190803 | shufflon protein C | - |
HS364_RS00510 (D616_p129107) | 88031..89293 | + | 1263 | WP_000608644 | IS1380-like element ISEcp1 family transposase | - |
HS364_RS00515 (D616_p129108) | 89581..90456 | + | 876 | WP_013188473 | extended-spectrum class A beta-lactamase CTX-M-1 | - |
HS364_RS00520 (D616_p129109) | 90503..90847 | - | 345 | Protein_100 | WbuC family cupin fold metalloprotein | - |
HS364_RS00630 | 90847..91056 | + | 210 | Protein_101 | hypothetical protein | - |
HS364_RS00525 (D616_p129111) | 91437..91685 | + | 249 | WP_001349157 | hypothetical protein | - |
HS364_RS00530 (D616_p129112) | 91682..92974 | - | 1293 | WP_001417545 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
HS364_RS00535 (D616_p129113) | 92974..93630 | - | 657 | WP_001193553 | prepilin peptidase | - |
HS364_RS00540 (D616_p129114) | 93615..94175 | - | 561 | WP_000014116 | lytic transglycosylase domain-containing protein | virB1 |
HS364_RS00545 (D616_p129115) | 94185..94799 | - | 615 | WP_000959785 | type 4 pilus major pilin | - |
HS364_RS00550 (D616_p129116) | 94817..95914 | - | 1098 | WP_001208805 | type II secretion system F family protein | - |
HS364_RS00555 (D616_p129117) | 95927..97480 | - | 1554 | WP_000362202 | ATPase, T2SS/T4P/T4SS family | virB11 |
HS364_RS00560 (D616_p129118) | 97491..97943 | - | 453 | WP_001247334 | type IV pilus biogenesis protein PilP | - |
HS364_RS00565 (D616_p129119) | 97930..99225 | - | 1296 | WP_000752772 | type 4b pilus protein PilO2 | - |
HS364_RS00570 (D616_p129120) | 99218..100900 | - | 1683 | WP_000748143 | PilN family type IVB pilus formation outer membrane protein | - |
HS364_RS00575 (D616_p129121) | 100914..101351 | - | 438 | WP_000539807 | type IV pilus biogenesis protein PilM | - |
HS364_RS00580 (D616_p129122) | 101351..102418 | - | 1068 | WP_001302629 | type IV pilus biogenesis lipoprotein PilL | - |
Host bacterium
ID | 1037 | GenBank | NC_024979 |
Plasmid name | pESBL-305 | Incompatibility group | IncI1 |
Plasmid size | 107552 bp | Coordinate of oriT [Strand] | 53207..53316 [-] |
Host baterium | Escherichia coli |
Cargo genes
Drug resistance gene | dfrA17, aadA5, sul2, blaCTX-M-1 |
Virulence gene | - |
Metal resistance gene | - |
Degradation gene | - |
Symbiosis gene | - |
Anti-CRISPR | - |