Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100565
Name   oriT_pHS102707 in_silico
Organism   Escherichia coli
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NC_023907 (63130..63232 [+], 103 nt)
oriT length   103 nt
IRs (inverted repeats)      53..68, 75..90  (GTAAAGTTGGACCACC..GGTGGGCCTACTT)
Location of nic site      98..99
Conserved sequence flanking the
  nic site    		  TATCCTG|C
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 103 nt

>oriT_pHS102707
AGCCTCGCAGAGCAGGATTCCCGTTGAGCAGCCCAGCTGCGAATAAGGGAAGGTAAAGTTGGACCACCGTTTACGGTGGGCCTACTTTACATATCCTGCCCGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   637 GenBank   YP_009022955
Name   TraI_pHS102707 insolico UniProt ID   W6AWK4
Length   869 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 869 a.a.        Molecular weight: 96493.35 Da        Isoelectric Point: 10.4282

>YP_009022955.1 TraI (plasmid) [Escherichia coli]
MKNIKKSSFSGLADYITNPQSKQERVGVIKATNCQSQDVQDAVTEVNITQRLNTRSESDKTYHLVISFRP
GEKPSEDVLNAIEESICQSLGFGDHQRLSAVHHDTDNLHIHVAINKINPDTLTIHNPYNDYRVLAESCAY
LEKKYGLEVDNHMPTRSASENRAKDMERHSGIQSLLSWVKAECAEQLLNANSWQELHQAMRQNGLELRQK
GNGFVIAGPDGLAVKASSVDRSLSRAALEKKLGSFESSIPDTKPSRPSPEAIKQRFGSAANVNRPGDRPP
PMRENRQVHLGDVPVMQINSGKRYESKPLGSQGANTTELYGRYQSEQQRLTAARNEALRLAKVKRDRLIE
NAKRSGRLKRATIKLLKGPGVNKRYLYGLASKALGEELERANAIYKKDRQAAYDIHKRRTWADWLQFKAA
GGDDEALKTLRQRNAQQARKEANILHGDKVKKDGRIPGLKPDSVTKEGTIIYRVGESAIRDGGKRLDVSR
DAGDDGLHAALLMAKHRYGDKLTVNGSFEFKKRIVAVAAARELDVSFADPELEKLRQILTKKAAREREYI
HIPFEKRGKARQAGAMWDTEKKSWFVGPYATRDRIENFIRMNEEKDNEQRRQRYAGTERTDAGRERSGNG
NATGANEPGVTGRSTSADAGNGYGTSSSRRRTGTGDAVTTAGSQPGRSDDTRTGRSRAAEPNGERGHSKP
NVARPGRQPPPTAKNRLRAMSELGMVRIAGGSEVLLQGNVSDQLEHKTAERADQLRRDMAGAGGITTPAE
VKKPLSSAEKYINEREQKRLKGFDIPKHRGYNSTDKGLFEYAGQRKSGLETLALLKRDDEIVVMPVSDYT
ARRLSNLKVGESVTLTPSGSVRTTKGRSR

  Protein domains


Predicted by InterproScan.

Domain of unknown function (DUF5710) (DUF5710)

(557-598)

Large polyvalent protein-associated domain 7 (LPD7)

(463-547)

Relaxase/Mobilisation nuclease domain (Relaxase)

(5-243)


  Protein structure


Source ID Structure
AlphaFold DB W6AWK4


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 29432..39777

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HTC64_RS00160 24668..24865 - 198 WP_024252921 DUF905 family protein -
HTC64_RS00165 24955..25575 - 621 WP_250695700 hypothetical protein -
HTC64_RS00170 25536..25784 - 249 WP_024252919 antirestriction protein ArdR -
HTC64_RS00175 (D616_p113022) 25784..26092 - 309 WP_003019666 HigA family addiction module antitoxin -
HTC64_RS00180 26106..26399 - 294 Protein_34 type II toxin-antitoxin system RelE/ParE family toxin -
HTC64_RS00185 (D616_p113023) 27409..28285 - 877 Protein_35 plasmid replication initiator TrfA -
HTC64_RS00190 (D616_p113024) 28366..28737 - 372 WP_024269748 single-stranded DNA-binding protein -
HTC64_RS00195 28843..29247 + 405 WP_024252966 transcriptional regulator -
HTC64_RS00200 (D616_p113025) 29432..30388 + 957 WP_024269749 P-type conjugative transfer ATPase TrbB virB11
HTC64_RS00205 30502..30885 + 384 WP_024252964 TrbC/VirB2 family protein virB2
HTC64_RS00210 30888..31214 + 327 WP_024252963 conjugal transfer protein TrbD virB3
HTC64_RS00215 (D616_p113026) 31211..33754 + 2544 WP_024252962 VirB4 family type IV secretion/conjugal transfer ATPase virb4
HTC64_RS00220 (D616_p113027) 33751..34458 + 708 WP_024252961 VirB8/TrbF family protein virB8
HTC64_RS00225 (D616_p113028) 34474..35364 + 891 WP_024252960 P-type conjugative transfer protein TrbG virB9
HTC64_RS00230 35367..35819 + 453 WP_048269923 conjugal transfer protein TrbH -
HTC64_RS00235 (D616_p113029) 35823..37217 + 1395 WP_024252958 TrbI/VirB10 family protein virB10
HTC64_RS00240 (D616_p113030) 37230..38012 + 783 WP_048269922 P-type conjugative transfer protein TrbJ virB5
HTC64_RS00245 38022..38222 + 201 WP_172685636 hypothetical protein -
HTC64_RS00250 (D616_p113031) 38224..39777 + 1554 WP_024269751 P-type conjugative transfer protein TrbL virB6
HTC64_RS00255 39788..40093 + 306 WP_032310194 lipoprotein -
HTC64_RS00260 (D616_p113032) 40109..40879 + 771 WP_024269752 TrbN -
HTC64_RS00265 (D616_p113033) 40896..41582 + 687 WP_024252953 TraX family protein -
HTC64_RS00465 42035..42130 + 96 WP_003019619 DinQ-like type I toxin DqlB -
HTC64_RS00275 42191..42511 - 321 WP_024252952 hypothetical protein -
HTC64_RS00280 42914..43144 - 231 WP_039696288 hypothetical protein -
HTC64_RS00285 (D616_p113034) 43297..43827 - 531 WP_024252950 thermonuclease family protein -
HTC64_RS00290 (D616_p113035) 43817..44452 - 636 WP_024252949 recombinase family protein -

Host bacterium

ID   1025 GenBank   NC_023907
Plasmid name   pHS102707 Incompatibility group   IncP1
Plasmid size   69453 bp Coordinate of oriT [Strand]   63130..63232 [+]
Host baterium   Escherichia coli

Cargo genes

Drug resistance gene   fosA3, blaKPC-2
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -