Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100564
Name   oriT_pSTM2 in_silico
Organism   Salmonella enterica subsp. enterica serovar Typhimurium
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NC_023900 (84114..84223 [+], 110 nt)
oriT length   110 nt
IRs (inverted repeats)      IR1: 24..31, 35..42  (GTCGGGGC..GCCCTGAC)
 IR2: 49..65, 72..88  (GCAATTGTAATAGCGTC..GACGGTATTACAATTGC)
Location of nic site      96..97
Conserved sequence flanking the
  nic site  
 
 CATCCTG|T
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 110 nt

>oriT_pSTM2
TCACTTCAGGCTCCTTACGGGGTGTCGGGGCGAAGCCCTGACCAGATGGCAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTGCACATCCTGTCCCGTTTTTCAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   636 GenBank   YP_009022485
Name   Relaxase_pSTM2 insolico UniProt ID   Q79VV7
Length   899 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 104010.41 Da        Isoelectric Point: 7.4265

>YP_009022485.1 relaxase (plasmid) [Salmonella enterica subsp. enterica serovar Typhimurium]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELNLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVNDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCQAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPESRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDRSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG

  Protein domains


Predicted by InterproScan.

(62-314)


  Protein structure


Source ID Structure
AlphaFold DB Q79VV7


T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 48699..89763

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HTC41_RS00290 46415..48706 - 2292 WP_001289276 F-type conjugative transfer protein TrbC -
HTC41_RS00295 48699..49769 - 1071 WP_000151582 IncI1-type conjugal transfer protein TrbB trbB
HTC41_RS00300 49788..50996 - 1209 WP_000121273 IncI1-type conjugal transfer protein TrbA trbA
HTC41_RS00305 51303..52082 - 780 WP_275450201 protein FinQ -
HTC41_RS00310 52709..52861 + 153 WP_001303307 Hok/Gef family protein -
HTC41_RS00315 52933..53184 - 252 WP_001291965 hypothetical protein -
HTC41_RS00320 53256..54482 - 1227 WP_031623769 RNA-guided endonuclease TnpB family protein -
HTC41_RS00325 54541..54945 + 405 WP_001175009 IS200/IS605 family transposase -
HTC41_RS00560 55502..55597 + 96 WP_001303310 DinQ-like type I toxin DqlB -
HTC41_RS00330 55662..55946 - 285 WP_172685734 hypothetical protein -
HTC41_RS00335 56047..56256 - 210 WP_001140543 hemolysin expression modulator Hha -
HTC41_RS00340 56354..57016 - 663 WP_000644794 plasmid IncI1-type surface exclusion protein ExcA -
HTC41_RS00345 57087..59255 - 2169 WP_000698368 DotA/TraY family protein traY
HTC41_RS00350 59352..59936 - 585 WP_001037985 IncI1-type conjugal transfer protein TraX -
HTC41_RS00355 59965..61167 - 1203 WP_001189156 IncI1-type conjugal transfer protein TraW traW
HTC41_RS00360 61134..61748 - 615 WP_000337400 IncI1-type conjugal transfer protein TraV traV
HTC41_RS00365 61748..64792 - 3045 WP_001024775 IncI1-type conjugal transfer protein TraU traU
HTC41_RS00370 64882..65682 - 801 WP_001164788 IncI1-type conjugal transfer protein TraT traT
HTC41_RS00375 65666..65854 - 189 WP_001277255 putative conjugal transfer protein TraS -
HTC41_RS00380 65918..66322 - 405 WP_000086960 IncI1-type conjugal transfer protein TraR traR
HTC41_RS00385 66373..66900 - 528 WP_001055569 conjugal transfer protein TraQ traQ
HTC41_RS00390 66900..67604 - 705 WP_000801920 IncI1-type conjugal transfer protein TraP traP
HTC41_RS00395 67604..68893 - 1290 WP_001271997 conjugal transfer protein TraO traO
HTC41_RS00400 68896..69879 - 984 WP_001191878 IncI1-type conjugal transfer protein TraN traN
HTC41_RS00405 69890..70582 - 693 WP_000138552 DotI/IcmL family type IV secretion protein traM
HTC41_RS00410 70579..70926 - 348 WP_001055900 conjugal transfer protein traL
HTC41_RS00415 70944..74711 - 3768 WP_001141534 LPD7 domain-containing protein -
HTC41_RS00420 74801..75352 - 552 WP_000014584 phospholipase D family protein -
HTC41_RS00425 75367..75657 - 291 WP_001299214 hypothetical protein traK
HTC41_RS00430 75654..76802 - 1149 WP_001024972 plasmid transfer ATPase TraJ virB11
HTC41_RS00435 76799..77617 - 819 WP_000646097 IncI1-type conjugal transfer lipoprotein TraI traI
HTC41_RS00440 77614..78072 - 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
HTC41_RS00445 78467..79051 - 585 WP_000977522 histidine phosphatase family protein -
HTC41_RS00450 79111..80313 - 1203 WP_000976353 conjugal transfer protein TraF -
HTC41_RS00455 80399..81223 - 825 WP_001238927 conjugal transfer protein TraE traE
HTC41_RS00460 81374..82528 - 1155 WP_001139958 site-specific integrase -
HTC41_RS00465 83189..83344 + 156 WP_001302705 hypothetical protein -
HTC41_RS00565 83615..83836 + 222 Protein_94 prepilin -
HTC41_RS00475 83833..85257 - 1425 WP_001389385 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
HTC41_RS00480 85257..85913 - 657 WP_001389386 prepilin peptidase -
HTC41_RS00485 85898..86458 - 561 WP_000014116 lytic transglycosylase domain-containing protein virB1
HTC41_RS00490 86468..87082 - 615 WP_000959786 type 4 pilus major pilin -
HTC41_RS00495 87100..88197 - 1098 WP_001208805 type II secretion system F family protein -
HTC41_RS00500 88210..89763 - 1554 WP_000362202 ATPase, T2SS/T4P/T4SS family virB11
HTC41_RS00505 89774..90226 - 453 WP_001247334 type IV pilus biogenesis protein PilP -
HTC41_RS00510 90213..91508 - 1296 WP_000752772 type 4b pilus protein PilO2 -
HTC41_RS00515 91501..93183 - 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
HTC41_RS00520 93197..93634 - 438 WP_000539807 type IV pilus biogenesis protein PilM -
HTC41_RS00525 93634..94701 - 1068 WP_001739185 type IV pilus biogenesis lipoprotein PilL -


Host bacterium


ID   1024 GenBank   NC_023900
Plasmid name   pSTM2 Incompatibility group   IncI1
Plasmid size   96876 bp Coordinate of oriT [Strand]   84114..84223 [+]
Host baterium   Salmonella enterica subsp. enterica serovar Typhimurium

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrVA2