Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100557
Name   oriT_pEQ011 in_silico
Organism   Escherichia coli
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NC_023315 (36519..36797 [+], 279 nt)
oriT length   279 nt
IRs (inverted repeats)      220..227, 230..237  (GCAAAAAC..GTTTTTGC)
Location of nic site      246..247
Conserved sequence flanking the
  nic site    		  GTGGGGTGT|GG
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 279 nt

>oriT_pEQ011
CGCTAGCAGCGCCCCTGACGGTATCCTATAAAAAAACACACCGCGCCGCTAGCAGCACCCCTAATATAAAATAATGTTTTTTATAAAAATAGTCAGTACCACCCCTACAAAGCGGTGTCGGCGCGTTGCTGTAGCTGCGTTAACGACGCTGCTTTAAATAAATCAGATTTAAACAATATAAATCCACAAATACAACTCAATGATATTAAAGATAAATCAGCAAAAACTTGTTTTTGCGTGGGGTGTGGTGCTTTTAGTGGTGAGAACCACCAACCTGTT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   629 GenBank   YP_008997926
Name   TraI_pEQ011 insolico UniProt ID   W0FXP9
Length   1756 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 1756 a.a.        Molecular weight: 192035.87 Da        Isoelectric Point: 6.0025

>YP_008997926.1 IncF plasmid conjugative transfer DNA-nicking and unwinding protein TraI (plasmid) [Escherichia coli]
MMSIAQVRSAGSAGNYYTDKDNYYVLGSMGERWAGRGAEQLGLQGSVDKDVFTRLLEGRLPDGADLSRMQ
DGSNKHRPGYDLTFSAPKSVSMMAMLGGDKRLIDAHNQAVDFAVRQVEALASTRVMTDGQSETVLTGNLV
MALFNHDTSRDQEPQLHTHAVVANVTQHNGEWKTLSSDKVGKTGFIENVYANQIAFGRLYREKLKEQVEA
LGYETEVVGKHGMWEMPGVPVEAFSGRSQTIREAVGEDASLKSRDVAALDTRKSKQHVDPEIKMTEWMQT
LKETGFDIRAYRDAAEQRAYTRTQTPGPASQDGPDVQQAVTQAIAGLSERKVQFTYTDVLARTVGILPPE
AGVIERARAGIDEAISREQLIPLDREKGLFTSGIHVLDELSVRALSRDIMKQNRVTVHPEKSVPRTAGYS
DAVSVLAQDRPSLAIVSGQGGAAGQRERVAELVMMAREQGREVQIIAADRRSQMNLKQDERLSGELITGR
RQLLEGMAFTPGSTVIVDQGEKLSLKETLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKDAGVNTYRW
QGGEQRPATIISEPDRNVRYARLAGDFAASVKAGEESVAQVSGVREQAILTQAIRSELKTQGVLGHQEVT
MTALSPVWLDSRSRYLRDMYRPGMVMEQWNPETRSHDRYVIDRVTAQSHSLTLRDAQGETQVVRISSLDS
SWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVASVSEDAMTVVVPGRAEPASLPVADSPFTALKL
ENGWVETPGHSVSDSAKVFAAVTQMAMDNATLNGLARSGRDVRLYSSLDETRTAEKLARHPSFTVVSEQI
KARAGETSLETAISLQKAGLHTPAQQAIHLALPVLESKKLAFSMVDLLTEAKSFAAEGTGFTELGGEINA
QIKRGDLLYVDVAKGYGTGLLVSRASYEAEKSILRHILEGKEAVTPLMERVPGELMEKLTSGQRAATRMI
LETSDRFTVVQGYAGVGKTTQFRAVMSAVNMLPESERPRVVGLGPTHRAVGEMRSAGVDAQTLASFLHDT
QLQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIAAGGGRAVASGDTDQLQAIAPGQPFRLQQTRSA
ADVAIMKEIVRQTPELREAVYSLINRDVERALSGLESVKPSQVPRQEGAWVPEHSVTEFSHSQEAKLAEA
QQKAMLKGEAFPDIPMTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIHDAREKAGELGKEQVM
VPVLNTANIRDGELRRLSTWETHRDALVLVDNVYHRIAGISKDDGLITLEDAEGNTRLISPREAVAEGVT
LYTPDTIRVGTGDRMRFTKSDRERGYVANSVWTVTAVSGDSVTLSDGQQTRVIRPGQERAEQHIDLAYAI
TAHGAQGASETFAIALEGTEGNRKQMAGFESAYVALSRMKQHVQVYTDNRQGWTDAINNAVQKGTAHDVF
EPKPDREVMNAERLFSTARELRDVAAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDRNGKSAG
IWLNPLTTDDGNGLRGFSGEGRVKGSGDAQFVALQGSRNGESLLADNMQEGVRIARDNPDSGVVVRIAGE
GRPWNPGAITGGRVWGDIPDNSVQPGAGNGEPVTAEVLAQRQAEEAIRRETERRADEIVRKMAENKPDLP
DGKTEQAVREIAGQERDRAAITEREAALPESVLRESQREREAVREVARENLLQERLQQMERDMVRDLQKE
KTLGGD

  Protein domains


Predicted by InterproScan.

AAA domain (AAA_30)

(969-1156)

TrwC relaxase (TrwC)

(10-283)

DNA helicase TraI (TraI_C)

(1434-1557)

single-stranded DNA binding TraI N-terminal subdomain (ssDNA_TraI_N)

(575-627)

DNA relaxase TraI 2B/2B-like domain (TraI_2B)

(633-712)


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 10360..37365

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HTB63_RS00055 (D616_p111011) 10360..12558 - 2199 WP_024127866 type IV conjugative transfer system coupling protein TraD virb4
HTB63_RS00060 (D616_p111013) 12811..13542 - 732 WP_000850422 conjugal transfer complement resistance protein TraT -
HTB63_RS00065 (D616_p111014) 13574..14077 - 504 WP_000605510 hypothetical protein -
HTB63_RS00070 (D616_p111015) 14092..16914 - 2823 WP_001007026 conjugal transfer mating-pair stabilization protein TraG traG
HTB63_RS00075 (D616_p111016) 16911..18284 - 1374 WP_001137358 conjugal transfer pilus assembly protein TraH traH
HTB63_RS00080 (D616_p111017) 18284..18646 - 363 WP_001443292 P-type conjugative transfer protein TrbJ -
HTB63_RS00085 (D616_p111018) 18576..19121 - 546 WP_000052618 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
HTB63_RS00090 (D616_p111019) 19108..19392 - 285 WP_024127867 type-F conjugative transfer system pilin chaperone TraQ -
HTB63_RS00095 (D616_p111020) 19473..19787 + 315 WP_000415566 protein ArtA -
HTB63_RS00100 (D616_p111021) 19789..20136 - 348 WP_024127868 conjugal transfer protein TrbA -
HTB63_RS00105 (D616_p111022) 20152..20895 - 744 WP_001403429 type-F conjugative transfer system pilin assembly protein TraF traF
HTB63_RS00110 (D616_p111023) 20888..21145 - 258 WP_000864320 conjugal transfer protein TrbE -
HTB63_RS00115 (D616_p111024) 21172..22980 - 1809 WP_000821818 type-F conjugative transfer system mating-pair stabilization protein TraN traN
HTB63_RS00120 (D616_p111025) 22977..23615 - 639 WP_001104248 type-F conjugative transfer system pilin assembly protein TrbC trbC
HTB63_RS00125 (D616_p111026) 23643..24095 - 453 WP_000069427 hypothetical protein -
HTB63_RS00130 (D616_p111027) 24125..24586 - 462 WP_000277845 hypothetical protein -
HTB63_RS00135 (D616_p111028) 24612..25604 - 993 WP_000830183 conjugal transfer pilus assembly protein TraU traU
HTB63_RS00140 (D616_p111029) 25601..26233 - 633 WP_001203720 type-F conjugative transfer system protein TraW traW
HTB63_RS00145 (D616_p111030) 26230..26616 - 387 WP_000214086 type-F conjugative transfer system protein TrbI -
HTB63_RS00150 (D616_p111031) 26613..29240 - 2628 WP_024127869 type IV secretion system protein TraC virb4
HTB63_RS00155 (D616_p111033) 29400..29621 - 222 WP_001278689 conjugal transfer protein TraR -
HTB63_RS00160 (D616_p111034) 29755..30270 - 516 WP_000809906 type IV conjugative transfer system lipoprotein TraV traV
HTB63_RS00165 (D616_p111035) 30267..30518 - 252 WP_001038341 conjugal transfer protein TrbG -
HTB63_RS00170 (D616_p111036) 30515..30832 - 318 WP_001057292 conjugal transfer protein TrbD virb4
HTB63_RS00175 (D616_p111037) 30829..31401 - 573 WP_000002780 conjugal transfer pilus-stabilizing protein TraP -
HTB63_RS00180 (D616_p111038) 31391..32818 - 1428 WP_000146685 F-type conjugal transfer pilus assembly protein TraB traB
HTB63_RS00185 (D616_p111039) 32818..33546 - 729 WP_001230787 type-F conjugative transfer system secretin TraK traK
HTB63_RS00190 (D616_p111040) 33533..34099 - 567 WP_000399792 type IV conjugative transfer system protein TraE traE
HTB63_RS00195 (D616_p111041) 34121..34432 - 312 WP_000012106 type IV conjugative transfer system protein TraL traL
HTB63_RS00200 (D616_p111042) 34447..34839 - 393 WP_024127870 type IV conjugative transfer system pilin TraA -
HTB63_RS00205 (D616_p111043) 34873..35100 - 228 WP_000589558 conjugal transfer relaxosome protein TraY -
HTB63_RS00210 (D616_p111044) 35220..35927 - 708 WP_250147158 transcriptional regulator TraJ family protein -
HTB63_RS00215 (D616_p111045) 36059..36442 - 384 WP_001151530 conjugal transfer relaxosome DNA-binding protein TraM -
HTB63_RS00220 (D616_p111046) 36718..37365 + 648 WP_024127871 transglycosylase SLT domain-containing protein virB1
HTB63_RS00225 (D616_p111048) 37660..38481 - 822 WP_001234469 DUF932 domain-containing protein -
HTB63_RS00230 (D616_p111049) 38600..38887 - 288 WP_000107542 hypothetical protein -
HTB63_RS00235 (D616_p111050) 38912..39118 - 207 WP_000275853 hypothetical protein -
HTB63_RS00490 39188..39361 + 174 Protein_47 hypothetical protein -
HTB63_RS00495 39359..39589 - 231 WP_001426396 hypothetical protein -
HTB63_RS00240 (D616_p111053) 39809..39934 - 126 WP_001372321 type I toxin-antitoxin system Hok family toxin -
HTB63_RS00500 39876..40025 - 150 Protein_50 plasmid maintenance protein Mok -
HTB63_RS00245 (D616_p111055) 40204..40966 - 763 Protein_51 plasmid SOS inhibition protein A -
HTB63_RS00250 (D616_p111056) 40963..41397 - 435 WP_000845953 conjugation system SOS inhibitor PsiB -

Host bacterium

ID   1017 GenBank   NC_023315
Plasmid name   pEQ011 Incompatibility group   IncFII
Plasmid size   85507 bp Coordinate of oriT [Strand]   36519..36797 [+]
Host baterium   Escherichia coli

Cargo genes

Drug resistance gene   blaCMY-2
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -