Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100550
Name   oriT_pJJ1886_3 in_silico
Organism   Escherichia coli JJ1886
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NC_022662 (5253..5336 [+], 84 nt)
oriT length   84 nt
IRs (inverted repeats)      4..13, 17..26  (GTGTCGGGGC..GCCCTGACCC)
Location of nic site      57..58
Conserved sequence flanking the
  nic site  
 
 CTGG|CTTA
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 84 nt

>oriT_pJJ1886_3
GGGGTGTCGGGGCGAAGCCCTGACCCAGTCACGTAGCGATAGCGGAGTGTATACTGGCTTAACCATTCGGCATCAGTGCGGATT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   622 GenBank   WP_000955999
Name   MobC_pJJ1886_3 insolico UniProt ID   _
Length   107 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 107 a.a.        Molecular weight: 11855.71 Da        Isoelectric Point: 10.8973

>WP_000955999.1 MULTISPECIES: MobC family plasmid mobilization relaxosome protein [Bacteria]
MLTIRVTDDEHARLLERCEGKQLAVWMRRVCLGEPVARSGKLPTLAPPLLRQLAAIGNNLNQTARKVNSG
QWSSGDRVQVVAALMAIGDELRRLRLAVREQGARDDS

  Protein domains


Predicted by InterproScan.

(50-94)


  Protein structure



No available structure.




Host bacterium


ID   1010 GenBank   NC_022662
Plasmid name   pJJ1886_3 Incompatibility group   ColRNAI
Plasmid size   5631 bp Coordinate of oriT [Strand]   5253..5336 [+]
Host baterium   Escherichia coli JJ1886

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -