Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100546
Name   oriT_pSCEC2 in_silico
Organism   Escherichia coli
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NC_022377 (50319..50869 [+], 551 nt)
oriT length   551 nt
IRs (inverted repeats)      IR1: 62..70, 71..79  (AACCCTTTC..GACAGGGTT)
  IR2: 143..150, 154..161  (TGGCCTGC..GGAGGCCA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 551 nt

>oriT_pSCEC2
TGTAAAGAGGCTGTGAAAGAATAAGAGCATCAAGATTCCAGATAGATAGAGGGAAATTTGACAAATTCCAAAGATGGGTTAGCCTAGTGACAGAACTAGATTCCAGTATTGGAATAATCAGCTTTAAATTCCAGATAGATAGTTATGTGGATAGGAATTGGATAGGAATTGGGAGGGTATTGAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   618 GenBank   YP_008575006
Name   TraI_pSCEC2 insolico UniProt ID   G0XAC3
Length   992 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 992 a.a.        Molecular weight: 109581.85 Da        Isoelectric Point: 4.8956

>YP_008575006.1 type IV conjugative transfer system protein TraI (plasmid) [Escherichia coli]
MLKALNKLFGGRSGVIETAPSARVLPLKDVEDEEIPRYPPFAKGLPVAPLDKILATQAELIEKVRNSLGF
TVDDFNRLVLPVIQRYAAFVHLLPASESHHHRGAGGLFRHGLEVAFWAAQASESVIFSIEGTPRERRDNE
PRWRLASCFSGLLHDVGKPLSDVSITDKDGSITWNPYSESLHDWAHRHEIDRYFIRWRDKRHKRHEQFSL
LAVDRIIPAETREFLSKSGPSIMEAMLEAISGTSVNQPVTKLMLRADQESVSRDLRQSRLDVDEFSYGVP
VERYVFDAIRRLVKTGKWKVNEPGAKVWHLNQGVFIAWKQLGDLYDLISHDKIPGIPRDPDTLADILIER
GFAVPNTVQEKGERAYYRYWEVLPEMLQEAAGSVKILMLRLESNDLVFTTEPPAAVAAEVVGDVEDAEIE
FVDPEEADDGDDQEEGEAALNDDMLAAEQEAEKALAGLGFGDAMEMLKSTSDAVEEKPEQKDAGPTESSK
PDAGKKGKPQSKPGKAKPKSDTEKQPHKPEAKEDLSPQDIAKNAPPLANDNPLQALKDVGGGLGDIDFPF
DAFNASAETTSTDATNSEIPDVAMPGKQEEQPKQDFVPQEQNSLQGDDFPMFGGSDEPPSWAIEPLPMLT
DAPEQPTHTPEMPHTDNVNQHEKDAKTLLVEMLSGYGEASALLEQAIMPVLEGKTTLGEVLCLMKGQAVI
LYPDGARSLGAPSEVLSKLSHANAIVPDPIMPGRKVRDFSGVKAIVLAEQLSDAVVAAIKDAEASMGGYQ
DAFELVSPPGLDASKNKSAPKQQSRKKAQQQKPEVNAGKASPEQKAKGKDSQPQPKEKKVDVTSPVEEQQ
RKPVQEKQNVARLPKREAQPVAPEPKVEREKELGHVEVREREDPEVREFEPPKAKTNPKDINAEDFLPSG
VTPQKALQMLKDMIQKRSGRWLVTPVLEEDGCLVTSDKAFDMIAGENIGISKHILCGMLSRAQRRPLLKK
RQGKLYLEVNET

  Protein domains


Predicted by InterproScan.

Putative helicase (TraI_2)

(51-357)


  Protein structure


Source ID Structure
AlphaFold DB G0XAC3


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 48453..73645

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HTB81_RS00355 44478..44711 - 234 WP_001191892 hypothetical protein -
HTB81_RS00360 44693..45310 - 618 WP_172685501 hypothetical protein -
HTB81_RS00365 (pSCEC2_026) 45478..48456 + 2979 WP_001337757 MobH family relaxase -
HTB81_RS00370 (pSCEC2_027) 48453..50318 + 1866 WP_000178856 conjugative transfer system coupling protein TraD virb4
HTB81_RS00375 (pSCEC2_028) 50329..50913 + 585 WP_000332866 hypothetical protein -
HTB81_RS00380 (pSCEC2_029) 50870..51499 + 630 WP_000743450 DUF4400 domain-containing protein tfc7
HTB81_RS00385 51509..51955 + 447 WP_000122506 hypothetical protein -
HTB81_RS00390 51965..52342 + 378 WP_000869261 hypothetical protein -
HTB81_RS00395 52342..53004 + 663 WP_001231463 hypothetical protein -
HTB81_RS00400 53185..53328 + 144 WP_001275801 hypothetical protein -
HTB81_RS00405 53340..53705 + 366 WP_001052531 hypothetical protein -
HTB81_RS00410 53851..54132 + 282 WP_000805625 type IV conjugative transfer system protein TraL traL
HTB81_RS00415 54129..54755 + 627 WP_001049716 TraE/TraK family type IV conjugative transfer system protein traE
HTB81_RS00420 (pSCEC2_030) 54739..55656 + 918 WP_000794249 type-F conjugative transfer system secretin TraK traK
HTB81_RS00425 (pSCEC2_031) 55656..56969 + 1314 WP_024131605 TraB/VirB10 family protein traB
HTB81_RS00430 (pSCEC2_032) 56966..57544 + 579 WP_000793435 type IV conjugative transfer system lipoprotein TraV traV
HTB81_RS00435 57548..57940 + 393 WP_000479535 TraA family conjugative transfer protein -
HTB81_RS00440 (pSCEC2_033) 58141..63672 + 5532 WP_000606833 Ig-like domain-containing protein -
HTB81_RS00445 (pSCEC2_034) 63821..64528 + 708 WP_001259347 DsbC family protein -
HTB81_RS00450 (pSCEC2_035) 64525..66972 + 2448 WP_000637386 type IV secretion system protein TraC virb4
HTB81_RS00455 66987..67304 + 318 WP_000351984 hypothetical protein -
HTB81_RS00460 (pSCEC2_036) 67301..67831 + 531 WP_001010738 S26 family signal peptidase -
HTB81_RS00465 (pSCEC2_037) 67794..69059 + 1266 WP_000621288 TrbC family F-type conjugative pilus assembly protein traW
HTB81_RS00470 (pSCEC2_038) 69056..69727 + 672 WP_001337754 EAL domain-containing protein -
HTB81_RS00475 (pSCEC2_039) 69727..70731 + 1005 WP_043940352 TraU family protein traU
HTB81_RS00480 (pSCEC2_040) 70847..73645 + 2799 WP_001256487 conjugal transfer mating pair stabilization protein TraN traN
HTB81_RS00485 73684..74544 - 861 WP_000709517 hypothetical protein -
HTB81_RS00490 74667..75308 - 642 WP_000796664 hypothetical protein -
HTB81_RS00495 75602..75922 + 321 WP_000547566 hypothetical protein -
HTB81_RS00500 76160..76411 + 252 WP_001447717 hypothetical protein -
HTB81_RS00505 (pSCEC2_041) 76631..77599 + 969 WP_000085162 AAA family ATPase -
HTB81_RS00510 77610..78518 + 909 WP_000739139 hypothetical protein -

Host bacterium

ID   1006 GenBank   NC_022377
Plasmid name   pSCEC2 Incompatibility group   IncA/C2
Plasmid size   135615 bp Coordinate of oriT [Strand]   50319..50869 [+]
Host baterium   Escherichia coli

Cargo genes

Drug resistance gene   floR, tet(A), aph(6)-Id, aph(3'')-Ib, sul2, cfr
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -