Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100533
Name   oriT_pSEEH1578_01 in_silico
Organism   Salmonella enterica subsp. enterica serovar Heidelberg str. 41578
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NC_021811 (31180..31282 [+], 103 nt)
oriT length   103 nt
IRs (inverted repeats)      IR1: 19..26, 30..37  (GTCGGGGC..GCCCTGAC)
 IR2: 44..58, 67..81  (GCAATTGTATAATCG..CGGTTATACAATTGC)
Location of nic site      89..90
Conserved sequence flanking the
  nic site    		  CATCCTG|T
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 103 nt

>oriT_pSEEH1578_01
TCAGCTCCTTACTGGGGTGTCGGGGCGAAGCCCTGACCAGGAGGCAATTGTATAATCGCGCGTGCGCGGTTATACAATTGCACATCCTGTCCCGTTTTTCAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   604 GenBank   WP_001354015
Name   NikB_pSEEH1578_01 insolico UniProt ID   _
Length   899 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 104018.47 Da        Isoelectric Point: 7.3526

>WP_001354015.1 MULTISPECIES: IncI1-type relaxase NikB [Enterobacteriaceae]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVHDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCLAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPENRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDKSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(62-314)


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 804..25814

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SEEH1578_RS23180 (SEEH1578_00010) 804..1952 + 1149 WP_001024972 plasmid transfer ATPase TraJ virB11
SEEH1578_RS25590 1949..2239 + 291 WP_001299214 hypothetical protein traK
SEEH1578_RS23185 (SEEH1578_00020) 2254..2805 + 552 WP_000014583 phospholipase D family protein -
SEEH1578_RS23190 (SEEH1578_00025) 2895..6662 + 3768 WP_001141529 LPD7 domain-containing protein -
SEEH1578_RS23195 (SEEH1578_00030) 6680..7027 + 348 WP_001055900 conjugal transfer protein traL
SEEH1578_RS23200 (SEEH1578_00035) 7024..7716 + 693 WP_000138548 DotI/IcmL family type IV secretion protein traM
SEEH1578_RS23205 (SEEH1578_00040) 7727..8710 + 984 WP_001191877 IncI1-type conjugal transfer protein TraN traN
SEEH1578_RS23210 (SEEH1578_00045) 8713..10002 + 1290 WP_001272005 conjugal transfer protein TraO traO
SEEH1578_RS23215 (SEEH1578_00050) 10002..10706 + 705 WP_000801920 IncI1-type conjugal transfer protein TraP traP
SEEH1578_RS23220 (SEEH1578_00055) 10706..11233 + 528 WP_001055569 conjugal transfer protein TraQ traQ
SEEH1578_RS23225 (SEEH1578_00060) 11284..11688 + 405 WP_000086957 IncI1-type conjugal transfer protein TraR traR
SEEH1578_RS23230 (SEEH1578_00065) 11752..11940 + 189 WP_001277255 putative conjugal transfer protein TraS -
SEEH1578_RS23235 (SEEH1578_00070) 11924..12724 + 801 WP_001164788 IncI1-type conjugal transfer protein TraT traT
SEEH1578_RS23240 (SEEH1578_00075) 12814..15858 + 3045 WP_001024780 IncI1-type conjugal transfer protein TraU traU
SEEH1578_RS25595 (SEEH1578_00080) 15858..16472 + 615 WP_000337398 IncI1-type conjugal transfer protein TraV traV
SEEH1578_RS23245 (SEEH1578_00085) 16439..17641 + 1203 WP_001189160 IncI1-type conjugal transfer protein TraW traW
SEEH1578_RS23250 (SEEH1578_00090) 17670..18254 + 585 WP_001037987 IncI1-type conjugal transfer protein TraX -
SEEH1578_RS23255 (SEEH1578_00095) 18351..20513 + 2163 WP_000698351 DotA/TraY family protein traY
SEEH1578_RS23260 (SEEH1578_00100) 20578..21240 + 663 WP_000653334 plasmid IncI1-type surface exclusion protein ExcA -
SEEH1578_RS23265 (SEEH1578_00105) 21312..21521 - 210 WP_000062603 HEAT repeat domain-containing protein -
SEEH1578_RS26730 (SEEH1578_00110) 21913..22089 + 177 WP_001054904 hypothetical protein -
SEEH1578_RS27100 22154..22249 - 96 WP_000609148 DinQ-like type I toxin DqlB -
SEEH1578_RS27105 (SEEH1578_00120) 22810..23001 + 192 WP_174715448 hypothetical protein -
SEEH1578_RS23275 (SEEH1578_00125) 23073..23225 - 153 WP_001331364 Hok/Gef family protein -
SEEH1578_RS23280 (SEEH1578_00130) 23517..24725 + 1209 WP_000121274 IncI1-type conjugal transfer protein TrbA trbA
SEEH1578_RS23285 (SEEH1578_00135) 24744..25814 + 1071 WP_000151583 IncI1-type conjugal transfer protein TrbB trbB
SEEH1578_RS23290 (SEEH1578_00140) 25807..28098 + 2292 WP_001289276 F-type conjugative transfer protein TrbC -

Host bacterium

ID   994 GenBank   NC_021811
Plasmid name   pSEEH1578_01 Incompatibility group   IncI1
Plasmid size   117929 bp Coordinate of oriT [Strand]   31180..31282 [+]
Host baterium   Salmonella enterica subsp. enterica serovar Heidelberg str. 41578

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   copper resistance
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -