Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 100530 |
| Name | oriT_pKPoxa-48N2  |
| Organism | Klebsiella pneumoniae |
| Sequence Completeness | core |
| NCBI accession of oriT (coordinates [strand]) | NC_021502 (1895..2000 [+], 106 nt) |
| oriT length | 106 nt |
| IRs (inverted repeats) | 18..35, 41..58 (GTTTTTGGAGTACCGCCG..CGGCGGCCGTCCAAAAAC) |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | predicted by the oriTfinder |
oriT sequence
Download Length: 106 nt
>oriT_pKPoxa-48N2
AGTACGGGACAAGATGTGTTTTTGGAGTACCGCCGACACGCGGCGGCCGTCCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTATCT
AGTACGGGACAAGATGTGTTTTTGGAGTACCGCCGACACGCGGCGGCCGTCCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTATCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Relaxase
| ID | 601 | GenBank | YP_008110802 |
| Name | MobA_pKPoxa-48N2 |
UniProt ID | _ |
| Length | 659 a.a. | PDB ID | |
| Note | putative relaxase | ||
Relaxase protein sequence
Download Length: 659 a.a. Molecular weight: 75179.89 Da Isoelectric Point: 9.9948
>YP_008110802.1 MobA (plasmid) [Klebsiella pneumoniae]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFADIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQFRSESDDKFNPK
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFADIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQFRSESDDKFNPK
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 4796..31937
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HTB51_RS00010 (D647_p28001) | 324..860 | + | 537 | WP_004187332 | hypothetical protein | - |
| HTB51_RS00015 (D647_p28002) | 1362..1727 | - | 366 | WP_004187330 | hypothetical protein | - |
| HTB51_RS01035 | 1756..2319 | + | 564 | WP_020277892 | plasmid mobilization protein MobA | - |
| HTB51_RS00025 (D647_p28029) | 2306..4285 | + | 1980 | WP_004187323 | TraI/MobA(P) family conjugative relaxase | - |
| HTB51_RS00030 (D647_p28028) | 4299..4799 | + | 501 | WP_004187320 | DotD/TraH family lipoprotein | - |
| HTB51_RS00035 (D647_p28027) | 4796..5575 | + | 780 | WP_004187315 | type IV secretory system conjugative DNA transfer family protein | traI |
| HTB51_RS00040 (D647_p28003) | 5586..6749 | + | 1164 | WP_004187313 | plasmid transfer ATPase TraJ | virB11 |
| HTB51_RS00045 | 6739..6999 | + | 261 | WP_004187310 | IcmT/TraK family protein | traK |
| HTB51_RS00050 (D647_p28031) | 7024..8586 | + | 1563 | WP_020277893 | toprim domain-containing protein | - |
| HTB51_RS00055 | 8586..10259 | + | 1674 | WP_227601284 | LPD7 domain-containing protein | - |
| HTB51_RS00060 (D647_p28004) | 10225..10737 | + | 513 | WP_011091071 | hypothetical protein | traL |
| HTB51_RS00065 | 10738..10950 | - | 213 | WP_305953721 | Hha/YmoA family nucleoid-associated regulatory protein | - |
| HTB51_RS00070 | 10922..11350 | - | 429 | WP_227626137 | H-NS family nucleoid-associated regulatory protein | - |
| HTB51_RS00075 (D647_p28026) | 11331..12113 | + | 783 | WP_015058941 | DotI/IcmL family type IV secretion protein | traM |
| HTB51_RS00080 (D647_p28025) | 12122..13273 | + | 1152 | WP_004187471 | DotH/IcmK family type IV secretion protein | traN |
| HTB51_RS00085 (D647_p28024) | 13285..14634 | + | 1350 | WP_004187474 | conjugal transfer protein TraO | traO |
| HTB51_RS00090 (D647_p28023) | 14646..15350 | + | 705 | WP_015060002 | conjugal transfer protein TraP | traP |
| HTB51_RS00095 (D647_p28008) | 15374..15904 | + | 531 | WP_004187478 | conjugal transfer protein TraQ | traQ |
| HTB51_RS00100 (D647_p28005) | 15921..16310 | + | 390 | WP_004187479 | DUF6750 family protein | traR |
| HTB51_RS00105 (D647_p28033) | 16356..16850 | + | 495 | WP_004187480 | hypothetical protein | - |
| HTB51_RS00110 (D647_p28007) | 16847..19897 | + | 3051 | WP_004187482 | hypothetical protein | traU |
| HTB51_RS00115 (D647_p28006) | 19894..21102 | + | 1209 | WP_011091082 | conjugal transfer protein TraW | traW |
| HTB51_RS00120 (D647_p28034) | 21099..21695 | + | 597 | WP_015060003 | hypothetical protein | - |
| HTB51_RS00125 (D647_p28035) | 21688..23883 | + | 2196 | WP_015062834 | DotA/TraY family protein | traY |
| HTB51_RS00130 (D647_p28036) | 23885..24538 | + | 654 | WP_015060005 | hypothetical protein | - |
| HTB51_RS00135 | 24619..24849 | + | 231 | WP_011091085 | IncL/M type plasmid replication protein RepC | - |
| HTB51_RS00140 (D647_p28020) | 25133..26200 | + | 1068 | WP_019725043 | plasmid replication initiator RepA | - |
| HTB51_RS01080 | 27423..27518 | + | 96 | WP_004206884 | DinQ-like type I toxin DqlB | - |
| HTB51_RS00145 (D647_p28019) | 27569..29656 | - | 2088 | WP_004206885 | conjugal transfer protein TrbC | - |
| HTB51_RS00150 (D647_p28010) | 29669..30619 | - | 951 | WP_004206886 | DsbC family protein | trbB |
| HTB51_RS00155 (D647_p28009) | 30630..31937 | - | 1308 | WP_015059988 | hypothetical protein | trbA |
| HTB51_RS00160 | 31937..32332 | - | 396 | WP_004187436 | lytic transglycosylase domain-containing protein | - |
| HTB51_RS00165 (D647_p28037) | 32437..32820 | - | 384 | WP_019725042 | DUF1496 domain-containing protein | - |
| HTB51_RS00170 | 32900..33334 | + | 435 | Protein_34 | CPBP family intramembrane glutamate endopeptidase | - |
| HTB51_RS00175 (D647_p28038) | 33349..34557 | - | 1209 | WP_001206290 | IS4-like element IS10A family transposase | - |
| HTB51_RS00180 (D647_p28017) | 34860..35771 | + | 912 | WP_015586033 | LysR family transcriptional regulator | - |
| HTB51_RS00185 (D647_p28011) | 36073..36870 | - | 798 | WP_015059991 | OXA-48 family carbapenem-hydrolyzing class D beta-lactamase OXA-48 | - |
Region 2: 102358..128406
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HTB51_RS00585 (D647_p28131) | 98802..99332 | + | 531 | WP_020277941 | antirestriction protein | - |
| HTB51_RS00590 (D647_p28088) | 99370..99777 | - | 408 | WP_020805750 | transglycosylase SLT domain-containing protein | - |
| HTB51_RS00595 (D647_p28086) | 100240..100656 | + | 417 | WP_072145360 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| HTB51_RS00600 (D647_p28083) | 100856..101575 | + | 720 | WP_020277942 | hypothetical protein | - |
| HTB51_RS00605 | 101708..101911 | + | 204 | WP_171486139 | TraY domain-containing protein | - |
| HTB51_RS00610 (D647_p28082) | 101976..102344 | + | 369 | WP_004194426 | type IV conjugative transfer system pilin TraA | - |
| HTB51_RS00615 (D647_p28077) | 102358..102663 | + | 306 | WP_004144424 | type IV conjugative transfer system protein TraL | traL |
| HTB51_RS00620 (D647_p28076) | 102683..103249 | + | 567 | WP_004144423 | type IV conjugative transfer system protein TraE | traE |
| HTB51_RS00625 (D647_p28058) | 103236..103976 | + | 741 | WP_004152497 | type-F conjugative transfer system secretin TraK | traK |
| HTB51_RS00630 | 103976..105399 | + | 1424 | Protein_129 | F-type conjugal transfer pilus assembly protein TraB | - |
| HTB51_RS00635 (D647_p28056) | 105472..106056 | + | 585 | WP_020277945 | type IV conjugative transfer system lipoprotein TraV | traV |
| HTB51_RS01060 | 106211..106609 | + | 399 | WP_020277946 | hypothetical protein | - |
| HTB51_RS01065 | 106680..106928 | + | 249 | WP_223175793 | hypothetical protein | - |
| HTB51_RS00645 (D647_p28133) | 106952..107170 | + | 219 | WP_004195468 | hypothetical protein | - |
| HTB51_RS00650 | 107171..107481 | + | 311 | Protein_134 | hypothetical protein | - |
| HTB51_RS00655 (D647_p28134) | 107548..107952 | + | 405 | WP_004197817 | hypothetical protein | - |
| HTB51_RS00660 | 108328..108726 | + | 399 | WP_023179972 | hypothetical protein | - |
| HTB51_RS00665 (D647_p28075) | 108798..111437 | + | 2640 | WP_020277948 | type IV secretion system protein TraC | virb4 |
| HTB51_RS00670 | 111437..111826 | + | 390 | WP_032736784 | type-F conjugative transfer system protein TrbI | - |
| HTB51_RS00675 (D647_p28059) | 111826..112452 | + | 627 | WP_020277949 | type-F conjugative transfer system protein TraW | traW |
| HTB51_RS00680 (D647_p28135) | 112494..112883 | + | 390 | WP_020277950 | hypothetical protein | - |
| HTB51_RS00685 (D647_p28074) | 112880..113869 | + | 990 | WP_009309872 | conjugal transfer pilus assembly protein TraU | traU |
| HTB51_RS00690 (D647_p28073) | 113882..114520 | + | 639 | WP_015065635 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| HTB51_RS00695 (D647_p28060) | 114579..116534 | + | 1956 | WP_020277951 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
| HTB51_RS00700 | 116566..116820 | + | 255 | WP_049194392 | conjugal transfer protein TrbE | - |
| HTB51_RS00705 | 116798..117046 | + | 249 | WP_004152675 | hypothetical protein | - |
| HTB51_RS00710 | 117059..117385 | + | 327 | WP_004144402 | hypothetical protein | - |
| HTB51_RS00715 | 117406..118158 | + | 753 | WP_004152677 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| HTB51_RS00720 | 118169..118408 | + | 240 | WP_004144400 | type-F conjugative transfer system pilin chaperone TraQ | - |
| HTB51_RS00725 | 118380..118937 | + | 558 | WP_013214031 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| HTB51_RS00730 (D647_p28072) | 118983..119426 | + | 444 | WP_020277953 | F-type conjugal transfer protein TrbF | - |
| HTB51_RS00735 (D647_p28071) | 119404..120783 | + | 1380 | WP_014343487 | conjugal transfer pilus assembly protein TraH | traH |
| HTB51_RS00740 (D647_p28061) | 120783..123632 | + | 2850 | WP_020277954 | conjugal transfer mating-pair stabilization protein TraG | traG |
| HTB51_RS00745 (D647_p28137) | 123635..124168 | + | 534 | WP_014343486 | conjugal transfer protein TraS | - |
| HTB51_RS00750 (D647_p28062) | 124354..125085 | + | 732 | WP_004152629 | conjugal transfer complement resistance protein TraT | - |
| HTB51_RS00755 (D647_p28138) | 125278..125967 | + | 690 | WP_014343485 | hypothetical protein | - |
| HTB51_RS00760 (D647_p28066) | 126094..128406 | + | 2313 | WP_020277955 | type IV conjugative transfer system coupling protein TraD | virb4 |
Host bacterium
| ID | 991 | GenBank | NC_021502 |
| Plasmid name | pKPoxa-48N2 | Incompatibility group | IncL/M |
| Plasmid size | 167203 bp | Coordinate of oriT [Strand] | 1895..2000 [+] |
| Host baterium | Klebsiella pneumoniae |
Cargo genes
| Drug resistance gene | blaOXA-48 |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | AcrIIA8, AcrIE9 |