Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100529
Name   oriT_pKPoxa-48N1 in_silico
Organism   Klebsiella pneumoniae
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NC_021488 (1895..2000 [+], 106 nt)
oriT length   106 nt
IRs (inverted repeats)      18..35, 41..58  (GTTTTTGGAGTACCGCCG..CGGCGGCCGTCCAAAAAC)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 106 nt

>oriT_pKPoxa-48N1
AGTACGGGACAAGATGTGTTTTTGGAGTACCGCCGACACGCGGCGGCCGTCCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTATCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   600 GenBank   YP_008090802
Name   MobA_pKPoxa-48N1 insolico UniProt ID   _
Length   659 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75179.89 Da        Isoelectric Point: 9.9948

>YP_008090802.1 MobA (plasmid) [Klebsiella pneumoniae]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFADIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQFRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(86-334)


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 4796..31937

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HTB22_RS00010 (D647_p27001) 324..860 + 537 WP_004187332 hypothetical protein -
HTB22_RS00015 (D647_p27038) 1362..1757 - 396 WP_019725163 hypothetical protein -
HTB22_RS00420 1756..2319 + 564 WP_020277892 plasmid mobilization protein MobA -
HTB22_RS00025 (D647_p27036) 2306..4285 + 1980 WP_004187323 TraI/MobA(P) family conjugative relaxase -
HTB22_RS00030 (D647_p27034) 4299..4799 + 501 WP_004187320 DotD/TraH family lipoprotein -
HTB22_RS00035 (D647_p27033) 4796..5575 + 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
HTB22_RS00040 (D647_p27002) 5586..6749 + 1164 WP_004187313 plasmid transfer ATPase TraJ virB11
HTB22_RS00045 6739..6999 + 261 WP_004187310 IcmT/TraK family protein traK
HTB22_RS00050 (D647_p27039) 7024..8586 + 1563 WP_020277893 toprim domain-containing protein -
HTB22_RS00055 8586..10259 + 1674 WP_227601284 LPD7 domain-containing protein -
HTB22_RS00060 (D647_p27003) 10225..10737 + 513 WP_011091071 hypothetical protein traL
HTB22_RS00065 10738..10935 - 198 WP_004187464 Hha/YmoA family nucleoid-associated regulatory protein -
HTB22_RS00070 10922..11332 - 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
HTB22_RS00075 (D647_p27031) 11331..12113 + 783 WP_015058941 DotI/IcmL family type IV secretion protein traM
HTB22_RS00080 (D647_p27028) 12122..13273 + 1152 WP_004187471 DotH/IcmK family type IV secretion protein traN
HTB22_RS00085 (D647_p27027) 13285..14634 + 1350 WP_004187474 conjugal transfer protein TraO traO
HTB22_RS00090 (D647_p27022) 14646..15350 + 705 WP_015060002 conjugal transfer protein TraP traP
HTB22_RS00095 (D647_p27007) 15374..15904 + 531 WP_004187478 conjugal transfer protein TraQ traQ
HTB22_RS00100 (D647_p27004) 15921..16310 + 390 WP_004187479 DUF6750 family protein traR
HTB22_RS00105 (D647_p27041) 16356..16850 + 495 WP_004187480 hypothetical protein -
HTB22_RS00110 (D647_p27006) 16847..19897 + 3051 WP_004187482 hypothetical protein traU
HTB22_RS00115 (D647_p27005) 19894..21102 + 1209 WP_011091082 conjugal transfer protein TraW traW
HTB22_RS00120 (D647_p27042) 21099..21695 + 597 WP_015060003 hypothetical protein -
HTB22_RS00125 (D647_p27043) 21688..23883 + 2196 WP_015062834 DotA/TraY family protein traY
HTB22_RS00130 (D647_p27044) 23885..24538 + 654 WP_015060005 hypothetical protein -
HTB22_RS00135 24607..24849 + 243 WP_023893611 IncL/M type plasmid replication protein RepC -
HTB22_RS00140 (D647_p27019) 25133..26200 + 1068 WP_019725043 plasmid replication initiator RepA -
HTB22_RS00435 27423..27518 + 96 WP_004206884 DinQ-like type I toxin DqlB -
HTB22_RS00145 (D647_p27018) 27569..29656 - 2088 WP_004206885 conjugal transfer protein TrbC -
HTB22_RS00150 (D647_p27009) 29669..30619 - 951 WP_004206886 DsbC family protein trbB
HTB22_RS00155 (D647_p27008) 30630..31937 - 1308 WP_015059988 hypothetical protein trbA
HTB22_RS00160 31937..32293 - 357 WP_015586032 lytic transglycosylase domain-containing protein -
HTB22_RS00165 (D647_p27045) 32437..32832 - 396 WP_015059989 DUF1496 domain-containing protein -
HTB22_RS00170 32900..33334 + 435 Protein_34 CPBP family intramembrane glutamate endopeptidase -
HTB22_RS00175 (D647_p27046) 33349..34557 - 1209 WP_001206290 IS4-like element IS10A family transposase -
HTB22_RS00180 (D647_p27016) 34860..35771 + 912 WP_015586033 LysR family transcriptional regulator -
HTB22_RS00185 (D647_p27010) 36073..36870 - 798 WP_015059991 OXA-48 family carbapenem-hydrolyzing class D beta-lactamase OXA-48 -

Host bacterium

ID   990 GenBank   NC_021488
Plasmid name   pKPoxa-48N1 Incompatibility group   IncL/M
Plasmid size   62592 bp Coordinate of oriT [Strand]   1895..2000 [+]
Host baterium   Klebsiella pneumoniae

Cargo genes

Drug resistance gene   blaOXA-48
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIIA8