Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100523
Name   oriT_pJEG011 in_silico
Organism   Klebsiella pneumoniae
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NC_021078 (42510..42615 [+], 106 nt)
oriT length   106 nt
IRs (inverted repeats)      18..35, 41..58  (GTTTTTGGAGTACCGCCG..CGGCGGCCGTCCAAAAAC)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 106 nt

>oriT_pJEG011
AGTACGGGACAAGATGTGTTTTTGGAGTACCGCCGACACGCGGCGGCCGTCCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTATCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   594 GenBank   YP_007878553
Name   MobA_pJEG011 insolico UniProt ID   G9I9E5
Length   658 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 658 a.a.        Molecular weight: 75080.76 Da        Isoelectric Point: 9.9948

>YP_007878553.1 MobA (plasmid) [Klebsiella pneumoniae]
MIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVDV
EPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLAS
MGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVNDR
QQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHKT
FADIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTAY
TPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSVS
DPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSSR
KKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLTE
SNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQNE
KHRLIREQNNSKNEMQFRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(85-333)


  Protein structure


Source ID Structure
AlphaFold DB G9I9E5


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 45411..71436

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HTA57_RS00290 (D647_p23073) 40496..40807 + 312 WP_004187333 hypothetical protein -
HTA57_RS00295 (D647_p23074) 40940..41476 + 537 WP_036970776 hypothetical protein -
HTA57_RS00300 (D647_p23039) 41977..42342 - 366 WP_015586046 hypothetical protein -
HTA57_RS00435 42407..42934 + 528 WP_172740549 plasmid mobilization protein MobA -
HTA57_RS00310 (D647_p23037) 42921..44900 + 1980 WP_004187323 TraI/MobA(P) family conjugative relaxase -
HTA57_RS00315 (D647_p23036) 44914..45414 + 501 WP_004187320 DotD/TraH family lipoprotein -
HTA57_RS00320 (D647_p23035) 45411..46190 + 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
HTA57_RS00325 (D647_p23034) 46201..47364 + 1164 WP_004187313 plasmid transfer ATPase TraJ virB11
HTA57_RS00330 (D647_p23033) 47354..47614 + 261 WP_004187310 IcmT/TraK family protein traK
HTA57_RS00440 47639..51076 + 3438 WP_015586048 LPD7 domain-containing protein -
HTA57_RS00340 (D647_p23032) 51042..51554 + 513 WP_011091071 hypothetical protein traL
HTA57_RS00345 51555..51752 - 198 WP_004187464 Hha/YmoA family nucleoid-associated regulatory protein -
HTA57_RS00350 51739..52149 - 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
HTA57_RS00355 (D647_p23031) 52148..52930 + 783 WP_015058941 DotI/IcmL family type IV secretion protein traM
HTA57_RS00360 (D647_p23030) 52939..54090 + 1152 WP_004187471 DotH/IcmK family type IV secretion protein traN
HTA57_RS00365 (D647_p23029) 54102..55451 + 1350 WP_004187474 conjugal transfer protein TraO traO
HTA57_RS00370 (D647_p23028) 55463..56167 + 705 WP_015060002 conjugal transfer protein TraP traP
HTA57_RS00375 (D647_p23027) 56191..56721 + 531 WP_004187478 conjugal transfer protein TraQ traQ
HTA57_RS00380 (D647_p23026) 56738..57127 + 390 WP_004187479 DUF6750 family protein traR
HTA57_RS00385 (D647_p23076) 57173..57667 + 495 WP_004187480 hypothetical protein -
HTA57_RS00390 (D647_p23077) 57664..60714 + 3051 WP_004187482 hypothetical protein traU
HTA57_RS00395 (D647_p23078) 60711..61919 + 1209 WP_011091082 conjugal transfer protein TraW traW
HTA57_RS00400 (D647_p23079) 61916..62512 + 597 WP_015060003 hypothetical protein -
HTA57_RS00405 (D647_p23080) 62505..64700 + 2196 WP_015062834 DotA/TraY family protein traY
HTA57_RS00410 (D647_p23081) 64702..65355 + 654 WP_015060005 hypothetical protein -
HTA57_RS00415 (D647_p23082) 65424..65666 + 243 WP_023893611 IncL/M type plasmid replication protein RepC -
HTA57_RS00420 (D647_p23084) 65950..67017 + 1068 WP_019725043 plasmid replication initiator RepA -
HTA57_RS00445 68240..68335 + 96 WP_004206884 DinQ-like type I toxin DqlB -
HTA57_RS00425 (D647_p23085) 68386..70473 - 2088 WP_004206885 conjugal transfer protein TrbC -
HTA57_RS00430 (D647_p23086) 70486..71436 - 951 WP_004206886 DsbC family protein trbB

Host bacterium

ID   984 GenBank   NC_021078
Plasmid name   pJEG011 Incompatibility group   IncL/M
Plasmid size   71446 bp Coordinate of oriT [Strand]   42510..42615 [+]
Host baterium   Klebsiella pneumoniae

Cargo genes

Drug resistance gene   blaOXA-48, blaCTX-M-14b, aph(3'')-Ib, aph(3')-VIb, aph(6)-Id
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -