Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100503
Name   oriT_pTC2 in_silico
Organism   Providencia stuartii
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NC_019375 (85766..86316 [-], 551 nt)
oriT length   551 nt
IRs (inverted repeats)      IR1: 62..70, 71..79  (AACCCTTTC..GACAGGGTT)
  IR2: 143..150, 154..161  (TGGCCTGC..GGAGGCCA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 551 nt

>oriT_pTC2
TGTAAAGAGGCTGTGAAAGAATAAGAGCATCAAGATTCCAGATAGATAGAGGGAAATTTGACAAATTCCAAAGATGGGTTAGCCTAGTGACAGAACTAGATTCCAGTATTGGAATAATCAGCTTTAAATTCCAGATAGATAGTTATGTGGATAGGAATTGGATAGGAATTGGGAGGGTATTGAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   574 GenBank   YP_006965657
Name   TraI_pTC2 insolico UniProt ID   K0HF75
Length   992 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 992 a.a.        Molecular weight: 109581.85 Da        Isoelectric Point: 4.8956

>YP_006965657.1 TraI (plasmid) [Providencia stuartii]
MLKALNKLFGGRSGVIETAPSARVLPLKDVEDEEIPRYPPFAKGLPVAPLDKILATQAELIEKVRNSLGF
TVDDFNRLVLPVIQRYAAFVHLLPASESHHHRGAGGLFRHGLEVAFWAAQASESVIFSIEGTPRERRDNE
PRWRLASCFSGLLHDVGKPLSDVSITDKDGSITWNPYSESLHDWAHRHEIDRYFIRWRDKRHKRHEQFSL
LAVDRIIPAETREFLSKSGPSIMEAMLEAISGTSVNQPVTKLMLRADQESVSRDLRQSRLDVDEFSYGVP
VERYVFDAIRRLVKTGKWKVNEPGAKVWHLNQGVFIAWKQLGDLYDLISHDKIPGIPRDPDTLADILIER
GFAVPNTVQEKGERAYYRYWEVLPEMLQEAAGSVKILMLRLESNDLVFTTEPPAAVAAEVVGDVEDAEIE
FVDPEEADDGDDQEEGEAALNDDMLAAEQEAEKALAGLGFGDAMEMLKSTSDAVEEKPEQKDAGPTESSK
PDAGKKGKPQSKPGKAKPKSDTEKQPHKPEAKEDLSPQDIAKNAPPLANDNPLQALKDVGGGLGDIDFPF
DAFNASAETTSTDATNSEIPDVAMPGKQEEQPKQDFVPQEQNSLQGDDFPMFGGSDEPPSWAIEPLPMLT
DAPEQPTHTPEMPHTDNVNQHEKDAKTLLVEMLSGYGEASALLEQAIMPVLEGKTTLGEVLCLMKGQAVI
LYPDGARSLGAPSEVLSKLSHANAIVPDPIMPGRKVRDFSGVKAIVLAEQLSDAVVAAIKDAEASMGGYQ
DAFELVSPPGLDASKNKSAPKQQSRKKAQQQKPEVNAGKASPEQKAKGKDSQPQPKEKKVDVTSPVEEQQ
RKPVQEKQNVARLPKREAQPVAPEPKVEREKELGHVEVREREDPEVREFEPPKAKTNPKDINAEDFLPSG
VTPQKALQMLKDMIQKRSGRWLVTPVLEEDGCLVTSDKAFDMIAGENIGISKHILCGMLSRAQRRPLLKK
RQGKLYLEVNET

  Protein domains


Predicted by InterproScan.

Putative helicase (TraI_2)

(51-357)


  Protein structure


Source ID Structure
AlphaFold DB K0HF75


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 62991..88182

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HTA53_RS00345 (D736_p083) 58118..59026 - 909 WP_000739139 hypothetical protein -
HTA53_RS00350 (D736_p084) 59037..60005 - 969 WP_000085162 AAA family ATPase -
HTA53_RS00355 (D736_p085) 60225..60410 - 186 WP_001186917 hypothetical protein -
HTA53_RS00360 (D736_p086) 60714..61034 - 321 WP_000547566 hypothetical protein -
HTA53_RS00365 (D736_p087) 61328..61969 + 642 WP_000796664 hypothetical protein -
HTA53_RS00370 (D736_p088) 62092..62952 + 861 WP_000709517 hypothetical protein -
HTA53_RS00375 (D736_p061) 62991..65789 - 2799 WP_001256487 conjugal transfer mating pair stabilization protein TraN traN
HTA53_RS00380 (D736_p048) 65905..66909 - 1005 WP_043940352 TraU family protein traU
HTA53_RS00385 (D736_p089) 66909..67580 - 672 WP_001337754 EAL domain-containing protein -
HTA53_RS00390 (D736_p051) 67577..68842 - 1266 WP_000621288 TrbC family F-type conjugative pilus assembly protein traW
HTA53_RS00395 (D736_p049) 68805..69335 - 531 WP_001010738 S26 family signal peptidase -
HTA53_RS00400 (D736_p090) 69332..69649 - 318 WP_000351984 hypothetical protein -
HTA53_RS00405 (D736_p050) 69664..72111 - 2448 WP_000637386 type IV secretion system protein TraC virb4
HTA53_RS00410 (D736_p091) 72108..72815 - 708 WP_001259347 DsbC family protein -
HTA53_RS00415 (D736_p092) 72964..78495 - 5532 WP_000606833 Ig-like domain-containing protein -
HTA53_RS00420 (D736_p057) 78696..79088 - 393 WP_000479535 TraA family conjugative transfer protein -
HTA53_RS00425 (D736_p056) 79092..79670 - 579 WP_000793435 type IV conjugative transfer system lipoprotein TraV traV
HTA53_RS00430 (D736_p055) 79667..80980 - 1314 WP_024131605 TraB/VirB10 family protein traB
HTA53_RS00435 (D736_p054) 80980..81897 - 918 WP_000794249 type-F conjugative transfer system secretin TraK traK
HTA53_RS00440 (D736_p053) 81881..82507 - 627 WP_001049716 TraE/TraK family type IV conjugative transfer system protein traE
HTA53_RS00445 (D736_p052) 82504..82785 - 282 WP_000805625 type IV conjugative transfer system protein TraL traL
HTA53_RS00450 (D736_p093) 82930..83295 - 366 WP_001052531 hypothetical protein -
HTA53_RS00455 83307..83450 - 144 WP_001275801 hypothetical protein -
HTA53_RS00460 (D736_p094) 83631..84293 - 663 WP_001231463 hypothetical protein -
HTA53_RS00465 (D736_p095) 84293..84670 - 378 WP_000869261 hypothetical protein -
HTA53_RS00470 (D736_p096) 84680..85126 - 447 WP_000122506 hypothetical protein -
HTA53_RS00475 (D736_p097) 85136..85765 - 630 WP_000743450 DUF4400 domain-containing protein tfc7
HTA53_RS00480 (D736_p098) 85722..86306 - 585 WP_000332866 hypothetical protein -
HTA53_RS00485 (D736_p060) 86317..88182 - 1866 WP_000178856 conjugative transfer system coupling protein TraD virb4
HTA53_RS00490 (D736_p058) 88179..91157 - 2979 WP_001337757 MobH family relaxase -
HTA53_RS00495 (D736_p099) 91325..91942 + 618 WP_001249396 hypothetical protein -
HTA53_RS00500 91924..92157 + 234 WP_001191892 hypothetical protein -

Host bacterium

ID   964 GenBank   NC_019375
Plasmid name   pTC2 Incompatibility group   IncA/C2
Plasmid size   180184 bp Coordinate of oriT [Strand]   85766..86316 [-]
Host baterium   Providencia stuartii

Cargo genes

Drug resistance gene   mph(A), blaVIM-1, aac(6')-Il, dfrA1, ant(3'')-Ia, blaSHV-5, sul1, qacE, aadA2, dfrA12, aph(3')-Ia
Virulence gene   -
Metal resistance gene   merR, merT, merP, merC, merA, merD, merE
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -