Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100501
Name   oriT_pEl1573 in_silico
Organism   Enterobacter cloacae
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NC_019368 (28558..28663 [+], 106 nt)
oriT length   106 nt
IRs (inverted repeats)      18..35, 41..58  (GTTTTTGGAGTACCGCCG..CGGCGGCCGTCCAAAAAC)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 106 nt

>oriT_pEl1573
AGTACGGGACAAGATGTGTTTTTGGAGTACCGCCGACACGCGGCGGCCGTCCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTATCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   572 GenBank   YP_006965403
Name   MobA/NikB_pEl1573 insolico UniProt ID   J7KBG3
Length   658 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 658 a.a.        Molecular weight: 75135.84 Da        Isoelectric Point: 10.0285

>YP_006965403.1 MobA/NikB (plasmid) [Enterobacter cloacae]
MIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVDV
EPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLAS
MGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVNDR
QQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHKT
FADIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTAY
TPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPVYSPDKDRIADEYRKIAQHTRLVKNNVRHSVS
DPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSSR
KKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLTE
SNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQNE
KHRLIREQNNSKNEMQFRSERDDKFNPK

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(85-333)


  Protein structure


Source ID Structure
AlphaFold DB J7KBG3


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 31459..50607

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HTB14_RS00235 (D727_p1081) 26543..26854 + 312 WP_011091065 hypothetical protein -
HTB14_RS00240 (D727_p1080) 26987..27523 + 537 WP_011091066 hypothetical protein -
HTB14_RS00245 (D727_p1062) 28024..28389 - 366 WP_011091067 hypothetical protein -
HTB14_RS00565 28404..28982 + 579 WP_223811519 plasmid mobilization protein MobA -
HTB14_RS00255 (D727_p1060) 28969..30948 + 1980 WP_050868819 TraI/MobA(P) family conjugative relaxase -
HTB14_RS00260 (D727_p1059) 30962..31462 + 501 WP_004187320 DotD/TraH family lipoprotein -
HTB14_RS00265 (D727_p1058) 31459..32238 + 780 WP_015063359 type IV secretory system conjugative DNA transfer family protein traI
HTB14_RS00270 (D727_p1057) 32249..33412 + 1164 WP_004187313 plasmid transfer ATPase TraJ virB11
HTB14_RS00275 (D727_p1056) 33402..33662 + 261 WP_004187310 IcmT/TraK family protein traK
HTB14_RS00570 33687..36944 + 3258 WP_015063358 LPD7 domain-containing protein -
HTB14_RS00285 (D727_p1054) 36868..37422 + 555 WP_011154467 hypothetical protein traL
HTB14_RS00290 37423..37620 - 198 WP_004187464 Hha/YmoA family nucleoid-associated regulatory protein -
HTB14_RS00295 37607..38017 - 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
HTB14_RS00300 (D727_p1053) 38016..38798 + 783 WP_011091073 DotI/IcmL family type IV secretion protein traM
HTB14_RS00305 (D727_p1052) 38807..39958 + 1152 WP_011091074 DotH/IcmK family type IV secretion protein traN
HTB14_RS00310 (D727_p1051) 39970..41319 + 1350 WP_011091075 conjugal transfer protein TraO traO
HTB14_RS00315 (D727_p1050) 41331..42035 + 705 WP_011091076 conjugal transfer protein TraP traP
HTB14_RS00320 (D727_p1049) 42059..42589 + 531 WP_011091077 conjugal transfer protein TraQ traQ
HTB14_RS00325 (D727_p1048) 42606..42995 + 390 WP_011091078 DUF6750 family protein traR
HTB14_RS00330 (D727_p1076) 43041..43535 + 495 WP_011091080 hypothetical protein -
HTB14_RS00335 (D727_p1047) 43532..46582 + 3051 WP_011091081 hypothetical protein traU
HTB14_RS00340 (D727_p1046) 46579..47787 + 1209 WP_011091082 conjugal transfer protein TraW traW
HTB14_RS00345 (D727_p1045) 47784..48434 + 651 WP_011091083 hypothetical protein -
HTB14_RS00350 (D727_p1044) 48427..50607 + 2181 WP_004187492 DotA/TraY family protein traY
HTB14_RS00355 (D727_p1043) 50610..51263 + 654 WP_011091084 hypothetical protein -
HTB14_RS00360 (D727_p1042) 51320..51568 + 249 WP_015062836 IncL/M type plasmid replication protein RepC -
HTB14_RS00365 (D727_p1040) 51854..52921 + 1068 WP_050868820 plasmid replication initiator RepA -
HTB14_RS00370 (D727_p1039) 53976..54680 + 705 WP_001067834 IS6-like element IS26 family transposase -

Host bacterium

ID   962 GenBank   NC_019368
Plasmid name   pEl1573 Incompatibility group   IncL/M
Plasmid size   87731 bp Coordinate of oriT [Strand]   28558..28663 [+]
Host baterium   Enterobacter cloacae

Cargo genes

Drug resistance gene   resistance to gentamicin and tobramycin; resistance to chloramphenicol; resistance to sulphonamides
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -