Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100498
Name   oriT_R830b in_silico
Organism   Serratia marcescens
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NC_019344 (44498..44602 [+], 105 nt)
oriT length   105 nt
IRs (inverted repeats)      18..35, 42..59  (GTTTTTGGTACACCGCCG..CGGCAGTGACGCAAAAAC)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 105 nt

>oriT_R830b
AGTACGGGACAAGATGTGTTTTTGGTACACCGCCGGCACGCCGGCAGTGACGCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTAT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   569 GenBank   YP_006964608
Name   PutativerelaxaseofR830b insolico UniProt ID   I3W4P9
Length   659 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75186.91 Da        Isoelectric Point: 9.9948

>YP_006964608.1 conjugative DNA transfer protein (plasmid) [Serratia marcescens]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLIRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQNTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFADIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSIDERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQFRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(87-334)


  Protein structure


Source ID Structure
AlphaFold DB I3W4P9


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 47400..66509

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HS952_RS00325 (D739_p1068) 42484..42795 + 312 WP_015058934 hypothetical protein -
HS952_RS00330 (D739_p1069) 42928..43464 + 537 WP_015062822 hypothetical protein -
HS952_RS00335 (D739_p1072) 43965..44360 - 396 WP_019725163 hypothetical protein -
HS952_RS00340 (D739_p1074) 44606..44923 + 318 WP_004206923 plasmid mobilization protein MobA -
HS952_RS00345 (D739_p1075) 44910..46889 + 1980 WP_015062826 TraI/MobA(P) family conjugative relaxase -
HS952_RS00350 (D739_p1076) 46903..47403 + 501 WP_004187320 DotD/TraH family lipoprotein -
HS952_RS00355 (D739_p1077) 47400..48179 + 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
HS952_RS00360 (D739_p1078) 48190..49353 + 1164 WP_015062827 plasmid transfer ATPase TraJ virB11
HS952_RS00365 (D739_p1079) 49343..49603 + 261 WP_004187310 IcmT/TraK family protein traK
HS952_RS00525 49628..52885 + 3258 WP_015062828 LPD7 domain-containing protein -
HS952_RS00375 (D739_p1081) 52809..53363 + 555 WP_011154467 hypothetical protein traL
HS952_RS00380 (D739_p1082) 53364..53561 - 198 WP_004187464 Hha/YmoA family nucleoid-associated regulatory protein -
HS952_RS00385 (D739_p1083) 53548..53958 - 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
HS952_RS00390 (D739_p1084) 53957..54739 + 783 WP_015062829 DotI/IcmL family type IV secretion protein traM
HS952_RS00395 (D739_p1085) 54748..55899 + 1152 WP_011091074 DotH/IcmK family type IV secretion protein traN
HS952_RS00400 (D739_p1086) 55911..57260 + 1350 WP_015062830 conjugal transfer protein TraO traO
HS952_RS00405 (D739_p1087) 57272..57976 + 705 WP_015062831 conjugal transfer protein TraP traP
HS952_RS00410 (D739_p1088) 58000..58530 + 531 WP_011091077 conjugal transfer protein TraQ traQ
HS952_RS00415 (D739_p1089) 58547..58936 + 390 WP_015062832 DUF6750 family protein traR
HS952_RS00420 (D739_p1090) 58982..59476 + 495 WP_004187480 hypothetical protein -
HS952_RS00425 (D739_p1091) 59473..62523 + 3051 WP_015062833 IncI1 plasmid conjugative transfer protein TraU traU
HS952_RS00430 (D739_p1092) 62520..63728 + 1209 WP_004187486 conjugal transfer protein TraW traW
HS952_RS00435 (D739_p1093) 63725..64321 + 597 WP_015060003 hypothetical protein -
HS952_RS00440 (D739_p1094) 64314..66509 + 2196 WP_015062834 DotA/TraY family protein traY
HS952_RS00445 (D739_p1095) 66511..67164 + 654 WP_015062835 hypothetical protein -
HS952_RS00450 (D739_p1096) 67228..67476 + 249 WP_015062836 IncL/M type plasmid replication protein RepC -
HS952_RS00455 (D739_p1097) 67762..68829 + 1068 WP_172686394 plasmid replication initiator RepA -
HS952_RS00460 (D739_p1099) 69720..70175 - 456 WP_001166628 Hg(II)-responsive transcriptional regulator -
HS952_RS00465 (D739_p1100) 70247..70612 + 366 WP_001294656 mercuric ion transporter MerT -
HS952_RS00470 (D739_p1101) 70628..70903 + 276 WP_000732275 mercury resistance system periplasmic binding protein MerP -
HS952_RS00475 (D739_p1102) 70931..71356 + 426 WP_000522996 organomercurial transporter MerC -

Host bacterium

ID   959 GenBank   NC_019344
Plasmid name   R830b Incompatibility group   IncL/M
Plasmid size   81793 bp Coordinate of oriT [Strand]   44498..44602 [+]
Host baterium   Serratia marcescens

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   merE, merD, merB, merR2, merR, merT, merP, merC, merA
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -