Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100490
Name   oriT_pWZ7140 in_silico
Organism   Enterococcus faecalis
Sequence Completeness      incomplete
NCBI accession of oriT (coordinates [strand])   NC_019284 (34415..34461 [+], 47 nt)
oriT length   47 nt
IRs (inverted repeats)      IR1: 3..10, 12..19  (CATAGAAT..ATTCTTTG)
  IR2: 25..31, 32..38  (TTCAATC..GATTCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 47 nt

>oriT_pWZ7140
GTCATAGAATAATTCTTTGTTTTCTTCAATCGATTCAATAGAAATAT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   561 GenBank   YP_006961949
Name   Nickase_pWZ7140 insolico UniProt ID   E0X5B7
Length   654 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 654 a.a.        Molecular weight: 76612.47 Da        Isoelectric Point: 9.3564

>YP_006961949.1 nickase (plasmid) [Enterococcus faecalis]
MTIAKREGGKRSLIAMASYRSGEKLYSELYEKTNLYNHRTVKPEAFILKPDYVPNEFLDRQTLWNKMELA
EKSPNAQLCREVNVALPIELNNSDQRMLIEDFVKDNFVSEGMIADVAIHRDDENNPHAHIMLTMREVDSE
GNILNKRKRIPKLDENGNQIFNEKGQRVTVSIKTNDWDRKSLVSEIRKDWADKVNQYLKDRNIDQQITEK
SHAELGKKELPTIHEGFYSKKLEDKGVISELKRKNLEIQSYNDVLSELDKLENQEKVLKQDQNFTLKFEK
TFSPLEKKELKNLSKELKIFVNDENIDKRISELKRWENSLIFNNKMEIQKQRLMLSKISSERDMLTKANE
ILDKQAERFFKKSYPSLNIDKFSNHEVRAMVNETIFRKQLLNKDQLAEVIYNERVVEKEESKKIFKEKPF
QTSRYLDSKIKQVEDSITKENNPERKEILSIKKEKLIGIKQGLIEYVQSEVERKFDKNVSIDSVIEGEML
LAKADYYKTTDFSKVEGVARFSSEEINSMLEQSKGFLTNIQTVKIPNDCQGVFFVQDSMKHIDELSPLAK
HNLKKVVNRNAYLPDSDKIELSKEIENTNKDQSQELDKDVPEKNEVTVKMFQFAKSINRLLSGNQLQKKR
NLDKLIKQTKAKENQSLQRNIPLR

  Protein domains


Predicted by InterproScan.

MobA/MobL family (MobA_MobL)

(11-235)

Nicking enzyme C-terminal middle helical domain (NES_C_h)

(282-387)


  Protein structure


Source ID Structure
AlphaFold DB E0X5B7


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 37309..46396

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HS660_RS00180 (D686_p1042) 32883..33200 + 318 WP_000415964 hypothetical protein -
HS660_RS00185 (D686_p1012) 33239..33736 + 498 WP_000874092 DnaJ domain-containing protein -
HS660_RS00190 (D686_p1043) 33770..34075 + 306 WP_000351790 hypothetical protein -
HS660_RS00195 (D686_p1044) 34098..34355 - 258 WP_000002668 hypothetical protein -
HS660_RS00200 (D686_p1045) 34358..34657 - 300 WP_000431202 hypothetical protein -
HS660_RS00205 (D686_p1023) 34970..36934 + 1965 WP_013307845 MobA/MobL family protein -
HS660_RS00210 (D686_p1022) 36958..37290 + 333 WP_000713503 CagC family type IV secretion system protein -
HS660_RS00215 (D686_p1021) 37309..37692 + 384 WP_001083514 glycosyl transferase trsC
HS660_RS00220 (D686_p1020) 37709..38338 + 630 WP_000459258 hypothetical protein -
HS660_RS00225 (D686_p1019) 38349..40310 + 1962 WP_000411529 hypothetical protein virb4
HS660_RS00230 (D686_p1018) 40324..41676 + 1353 WP_000875579 hypothetical protein trsF
HS660_RS00235 (D686_p1016) 41698..42807 + 1110 WP_000501303 lysozyme family protein orf14
HS660_RS00240 (D686_p1046) 42820..43371 + 552 WP_000393725 hypothetical protein -
HS660_RS00245 (D686_p1015) 43376..43807 + 432 WP_001085135 hypothetical protein -
HS660_RS00250 (D686_p1017) 43800..45455 + 1656 WP_000096577 VirD4-like conjugal transfer protein, CD1115 family -
HS660_RS00255 (D686_p1047) 45473..46396 + 924 WP_001013727 hypothetical protein traP

Host bacterium

ID   951 GenBank   NC_019284
Plasmid name   pWZ7140 Incompatibility group   _
Plasmid size   47277 bp Coordinate of oriT [Strand]   34415..34461 [+]
Host baterium   Enterococcus faecalis

Cargo genes

Drug resistance gene   erm(B), VanHAX
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -