Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100483
Name   oriT_pWZ909 in_silico
Organism   Enterococcus faecalis
Sequence Completeness      incomplete
NCBI accession of oriT (coordinates [strand])   NC_019213 (29740..29786 [+], 47 nt)
oriT length   47 nt
IRs (inverted repeats)      IR1: 3..10, 12..19  (CATAGAAT..ATTCTTTG)
  IR2: 25..31, 32..38  (TTCAATC..GATTCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 47 nt

>oriT_pWZ909
GTCATAGAATAATTCTTTGTTTTCTTCAATCGATTCAATAGAAATAT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   554 GenBank   YP_006960588
Name   Nickase_pWZ909 insolico UniProt ID   E0X5B7
Length   654 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 654 a.a.        Molecular weight: 76612.47 Da        Isoelectric Point: 9.3564

>YP_006960588.1 nickase (plasmid) [Enterococcus faecalis]
MTIAKREGGKRSLIAMASYRSGEKLYSELYEKTNLYNHRTVKPEAFILKPDYVPNEFLDRQTLWNKMELA
EKSPNAQLCREVNVALPIELNNSDQRMLIEDFVKDNFVSEGMIADVAIHRDDENNPHAHIMLTMREVDSE
GNILNKRKRIPKLDENGNQIFNEKGQRVTVSIKTNDWDRKSLVSEIRKDWADKVNQYLKDRNIDQQITEK
SHAELGKKELPTIHEGFYSKKLEDKGVISELKRKNLEIQSYNDVLSELDKLENQEKVLKQDQNFTLKFEK
TFSPLEKKELKNLSKELKIFVNDENIDKRISELKRWENSLIFNNKMEIQKQRLMLSKISSERDMLTKANE
ILDKQAERFFKKSYPSLNIDKFSNHEVRAMVNETIFRKQLLNKDQLAEVIYNERVVEKEESKKIFKEKPF
QTSRYLDSKIKQVEDSITKENNPERKEILSIKKEKLIGIKQGLIEYVQSEVERKFDKNVSIDSVIEGEML
LAKADYYKTTDFSKVEGVARFSSEEINSMLEQSKGFLTNIQTVKIPNDCQGVFFVQDSMKHIDELSPLAK
HNLKKVVNRNAYLPDSDKIELSKEIENTNKDQSQELDKDVPEKNEVTVKMFQFAKSINRLLSGNQLQKKR
NLDKLIKQTKAKENQSLQRNIPLR

  Protein domains


Predicted by InterproScan.

MobA/MobL family (MobA_MobL)

(11-235)

Nicking enzyme C-terminal middle helical domain (NES_C_h)

(282-387)


  Protein structure


Source ID Structure
AlphaFold DB E0X5B7


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 32634..41721

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HS706_RS00160 (D686_p41) 28208..28525 + 318 WP_000415964 hypothetical protein -
HS706_RS00165 (D686_p12) 28564..29061 + 498 WP_000874092 DnaJ domain-containing protein -
HS706_RS00170 (D686_p42) 29095..29400 + 306 WP_000351790 hypothetical protein -
HS706_RS00175 (D686_p43) 29423..29680 - 258 WP_000002668 hypothetical protein -
HS706_RS00180 (D686_p44) 29683..29982 - 300 WP_000431202 hypothetical protein -
HS706_RS00185 (D686_p24) 30295..32259 + 1965 WP_013307845 MobA/MobL family protein -
HS706_RS00190 (D686_p23) 32283..32615 + 333 WP_000713503 CagC family type IV secretion system protein -
HS706_RS00195 (D686_p22) 32634..33017 + 384 WP_001083514 glycosyl transferase trsC
HS706_RS00200 (D686_p21) 33034..33663 + 630 WP_000459258 hypothetical protein -
HS706_RS00205 (D686_p20) 33674..35635 + 1962 WP_000411529 hypothetical protein virb4
HS706_RS00210 (D686_p19) 35649..37001 + 1353 WP_000875579 hypothetical protein trsF
HS706_RS00215 (D686_p18) 37023..38132 + 1110 WP_000501303 lysozyme family protein orf14
HS706_RS00220 (D686_p17) 38145..38696 + 552 WP_000393725 hypothetical protein -
HS706_RS00225 (D686_p16) 38701..39132 + 432 WP_001085135 hypothetical protein -
HS706_RS00230 (D686_p15) 39125..40780 + 1656 WP_000096577 VirD4-like conjugal transfer protein, CD1115 family -
HS706_RS00235 (D686_p45) 40798..41721 + 924 WP_001013727 hypothetical protein traP

Host bacterium

ID   944 GenBank   NC_019213
Plasmid name   pWZ909 Incompatibility group   _
Plasmid size   42602 bp Coordinate of oriT [Strand]   29740..29786 [+]
Host baterium   Enterococcus faecalis

Cargo genes

Drug resistance gene   erm(B), VanHAX
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -