Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100480
Name   oriT_pOXA-48 in_silico
Organism   Klebsiella pneumoniae
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NC_019154 (33088..33193 [+], 106 nt)
oriT length   106 nt
IRs (inverted repeats)      18..35, 41..58  (GTTTTTGGAGTACCGCCG..CGGCGGCCGTCCAAAAAC)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 106 nt

>oriT_pOXA-48
AGTACGGGACAAGATGTGTTTTTGGAGTACCGCCGACACGCGGCGGCCGTCCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTATCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   551 GenBank   YP_006958827
Name   MobA_pOXA-48 insolico UniProt ID   G9I9E5
Length   658 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 658 a.a.        Molecular weight: 75080.76 Da        Isoelectric Point: 9.9948

>YP_006958827.1 MobA (plasmid) [Klebsiella pneumoniae]
MIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVDV
EPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLAS
MGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVNDR
QQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHKT
FADIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTAY
TPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSVS
DPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSSR
KKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLTE
SNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQNE
KHRLIREQNNSKNEMQFRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

(85-333)


  Protein structure


Source ID Structure
AlphaFold DB G9I9E5


T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 35989..61868

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HS861_RS00260 (D647_p4063) 31073..31384 + 312 WP_004187333 hypothetical protein -
HS861_RS00265 (D647_p4064) 31517..32053 + 537 WP_011091066 hypothetical protein -
HS861_RS00270 (D647_p4065) 32555..32950 - 396 WP_019725163 hypothetical protein -
HS861_RS00420 32949..33512 + 564 WP_020277892 plasmid mobilization protein MobA -
HS861_RS00280 (D647_p4047) 33499..35478 + 1980 WP_004187323 TraI/MobA(P) family conjugative relaxase -
HS861_RS00285 (D647_p4046) 35492..35992 + 501 WP_004187320 DotD/TraH family lipoprotein -
HS861_RS00290 (D647_p4045) 35989..36768 + 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
HS861_RS00295 (D647_p4044) 36779..37942 + 1164 WP_004187313 plasmid transfer ATPase TraJ virB11
HS861_RS00300 37932..38192 + 261 WP_004187310 IcmT/TraK family protein traK
HS861_RS00305 38217..39569 + 1353 WP_172684945 toprim domain-containing protein -
HS861_RS00310 39532..41508 + 1977 WP_227626110 LPD7 domain-containing protein -
HS861_RS00315 (D647_p4035) 41474..41986 + 513 WP_011091071 hypothetical protein traL
HS861_RS00320 41987..42184 - 198 WP_004187464 Hha/YmoA family nucleoid-associated regulatory protein -
HS861_RS00325 42171..42581 - 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
HS861_RS00330 (D647_p4043) 42580..43362 + 783 WP_015058941 DotI/IcmL family type IV secretion protein traM
HS861_RS00335 (D647_p4042) 43371..44522 + 1152 WP_015060001 DotH/IcmK family type IV secretion protein traN
HS861_RS00340 (D647_p4041) 44534..45883 + 1350 WP_004187474 conjugal transfer protein TraO traO
HS861_RS00345 (D647_p4040) 45895..46599 + 705 WP_015060002 conjugal transfer protein TraP traP
HS861_RS00350 (D647_p4039) 46623..47153 + 531 WP_004187478 conjugal transfer protein TraQ traQ
HS861_RS00355 (D647_p4036) 47170..47559 + 390 WP_004187479 DUF6750 family protein traR
HS861_RS00360 (D647_p4067) 47605..48099 + 495 WP_004187480 hypothetical protein -
HS861_RS00365 (D647_p4038) 48096..51146 + 3051 WP_004187482 hypothetical protein traU
HS861_RS00370 (D647_p4037) 51143..52351 + 1209 WP_011091082 conjugal transfer protein TraW traW
HS861_RS00375 (D647_p4068) 52348..52944 + 597 WP_015060003 hypothetical protein -
HS861_RS00380 (D647_p4069) 52937..55132 + 2196 WP_015062834 DotA/TraY family protein traY
HS861_RS00385 (D647_p4070) 55134..55787 + 654 WP_015060005 hypothetical protein -
HS861_RS00390 (D647_p4071) 55856..56098 + 243 WP_023893611 IncL/M type plasmid replication protein RepC -
HS861_RS00395 (D647_p4073) 56382..57449 + 1068 WP_019725043 plasmid replication initiator RepA -
HS861_RS00425 58672..58767 + 96 WP_004206884 DinQ-like type I toxin DqlB -
HS861_RS00400 (D647_p4074) 58818..60905 - 2088 WP_004206885 conjugal transfer protein TrbC -
HS861_RS00405 (D647_p4075) 60918..61868 - 951 WP_004206886 DsbC family protein trbB


Host bacterium


ID   941 GenBank   NC_019154
Plasmid name   pOXA-48 Incompatibility group   IncL/M
Plasmid size   61881 bp Coordinate of oriT [Strand]   33088..33193 [+]
Host baterium   Klebsiella pneumoniae

Cargo genes


Drug resistance gene   blaOXA-48
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIIA8