Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100477
Name   oriT_pSD107 in_silico
Organism   Salmonella enterica subsp. enterica serovar Derby
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NC_019137 (54168..54270 [-], 103 nt)
oriT length   103 nt
IRs (inverted repeats)      IR1: 19..26, 30..37  (GTCGGGGC..GCCCTGAC)
 IR2: 44..58, 67..81  (GCAATTGTATAATCG..CGGTTATACAATTGC)
Location of nic site      89..90
Conserved sequence flanking the
  nic site  
 
 CATCCTG|T
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 103 nt

>oriT_pSD107
TCAGCTCCTTACTGGGGTGTCGGGGCGAAGCCCTGACCAGGAGGCAATTGTATAATCGCGCGTGCGCGGTTATACAATTGCACATCCTGTCCCGTTTTTCAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   548 GenBank   YP_006958004
Name   NikB_pSD107 insolico UniProt ID   K4K111
Length   899 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 104018.47 Da        Isoelectric Point: 7.3526

>YP_006958004.1 conjugal transfer relaxase protein NikB (plasmid) [Salmonella enterica subsp. enterica serovar Derby]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVHDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCLAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPENRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDKSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG

  Protein domains


Predicted by InterproScan.

(62-314)


  Protein structure


Source ID Structure
AlphaFold DB K4K111


T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 59636..97431

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HTB39_RS00340 (pSD107_095) 57352..59643 - 2292 WP_001289276 F-type conjugative transfer protein TrbC -
HTB39_RS00345 (pSD107_096) 59636..60706 - 1071 WP_000151583 IncI1-type conjugal transfer protein TrbB trbB
HTB39_RS00350 (pSD107_097) 60725..61933 - 1209 WP_000121274 IncI1-type conjugal transfer protein TrbA trbA
HTB39_RS00355 (pSD107_099) 62225..62377 + 153 WP_001331364 Hok/Gef family protein -
HTB39_RS00615 (pSD107_100) 62449..62640 - 192 WP_174715448 hypothetical protein -
HTB39_RS00610 63201..63296 + 96 WP_000609148 DinQ-like type I toxin DqlB -
HTB39_RS00365 (pSD107_102) 63361..63642 - 282 WP_015059947 hypothetical protein -
HTB39_RS00370 (pSD107_103) 63927..64136 + 210 WP_000062603 HEAT repeat domain-containing protein -
HTB39_RS00375 (pSD107_104) 64208..64870 - 663 WP_000653334 plasmid IncI1-type surface exclusion protein ExcA -
HTB39_RS00380 (pSD107_105) 64935..67097 - 2163 WP_000698351 DotA/TraY family protein traY
HTB39_RS00385 (pSD107_106) 67194..67778 - 585 WP_001037987 IncI1-type conjugal transfer protein TraX -
HTB39_RS00390 (pSD107_107) 67807..69009 - 1203 WP_001189160 IncI1-type conjugal transfer protein TraW traW
HTB39_RS00395 (pSD107_108) 68976..69590 - 615 WP_000337398 IncI1-type conjugal transfer protein TraV traV
HTB39_RS00400 (pSD107_109) 69590..72634 - 3045 WP_001024780 IncI1-type conjugal transfer protein TraU traU
HTB39_RS00405 (pSD107_110) 72724..73524 - 801 WP_001164788 IncI1-type conjugal transfer protein TraT traT
HTB39_RS00410 (pSD107_111) 73508..73696 - 189 WP_001277255 putative conjugal transfer protein TraS -
HTB39_RS00415 (pSD107_112) 73760..74164 - 405 WP_000086957 IncI1-type conjugal transfer protein TraR traR
HTB39_RS00420 (pSD107_113) 74215..74742 - 528 WP_001055569 conjugal transfer protein TraQ traQ
HTB39_RS00425 (pSD107_114) 74742..75446 - 705 WP_000801920 IncI1-type conjugal transfer protein TraP traP
HTB39_RS00430 (pSD107_115) 75446..76735 - 1290 WP_001272005 conjugal transfer protein TraO traO
HTB39_RS00435 (pSD107_116) 76738..77721 - 984 WP_001191877 IncI1-type conjugal transfer protein TraN traN
HTB39_RS00440 (pSD107_117) 77732..78424 - 693 WP_000138548 DotI/IcmL family type IV secretion protein traM
HTB39_RS00445 (pSD107_118) 78421..78768 - 348 WP_001055900 conjugal transfer protein traL
HTB39_RS00450 (pSD107_119) 78786..82553 - 3768 WP_001141529 LPD7 domain-containing protein -
HTB39_RS00455 (pSD107_120) 82643..83194 - 552 WP_000014583 phospholipase D family protein -
HTB39_RS00460 (pSD107_121) 83209..83499 - 291 WP_001299214 hypothetical protein traK
HTB39_RS00465 (pSD107_122) 83496..84644 - 1149 WP_001024972 plasmid transfer ATPase TraJ virB11
HTB39_RS00470 (pSD107_123) 84641..85459 - 819 WP_000646098 IncI1-type conjugal transfer lipoprotein TraI traI
HTB39_RS00475 (pSD107_124) 85456..85914 - 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
HTB39_RS00480 (pSD107_125) 86309..86893 - 585 WP_000977522 histidine phosphatase family protein -
HTB39_RS00485 (pSD107_126) 86953..88155 - 1203 WP_000976351 conjugal transfer protein TraF -
HTB39_RS00490 (pSD107_127) 88240..89064 - 825 WP_001238939 conjugal transfer protein TraE traE
HTB39_RS00495 (pSD107_128) 89215..90369 - 1155 WP_001139957 site-specific integrase -
HTB39_RS00500 (pSD107_129) 90368..90679 + 312 WP_000958120 hypothetical protein -
HTB39_RS00605 91488..91637 + 150 WP_001302708 hypothetical protein -
HTB39_RS00510 (pSD107_133) 91634..92926 - 1293 WP_001417545 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
HTB39_RS00515 (pSD107_134) 92926..93581 - 656 Protein_104 prepilin peptidase -
HTB39_RS00520 (pSD107_135) 93566..94126 - 561 WP_000014116 lytic transglycosylase domain-containing protein virB1
HTB39_RS00525 (pSD107_136) 94136..94750 - 615 WP_000959785 type 4 pilus major pilin -
HTB39_RS00530 (pSD107_137) 94768..95865 - 1098 WP_001208805 type II secretion system F family protein -
HTB39_RS00535 (pSD107_138) 95878..97431 - 1554 WP_000362202 ATPase, T2SS/T4P/T4SS family virB11
HTB39_RS00540 (pSD107_139) 97442..97894 - 453 WP_001247336 type IV pilus biogenesis protein PilP -
HTB39_RS00545 (pSD107_140) 97881..99176 - 1296 WP_000752774 type 4b pilus protein PilO2 -
HTB39_RS00550 (pSD107_141) 99169..100852 - 1684 Protein_111 PilN family type IVB pilus formation outer membrane protein -
HTB39_RS00555 (pSD107_142) 100866..101303 - 438 WP_000539807 type IV pilus biogenesis protein PilM -
HTB39_RS00560 (pSD107_143) 101303..102370 - 1068 WP_000742600 type IV pilus biogenesis lipoprotein PilL -


Host bacterium


ID   938 GenBank   NC_019137
Plasmid name   pSD107 Incompatibility group   IncI1
Plasmid size   107637 bp Coordinate of oriT [Strand]   54168..54270 [-]
Host baterium   Salmonella enterica subsp. enterica serovar Derby

Cargo genes


Drug resistance gene   sul1, qacE, ant(3'')-Ia, dfrA1, aph(6)-Id, aph(3'')-Ib, sul2, blaTEM-1B
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -