Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100469
Name   oriT_pSH111_166 in_silico
Organism   Salmonella enterica subsp. enterica serovar Heidelberg
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NC_019121 (117220..117770 [-], 551 nt)
oriT length   551 nt
IRs (inverted repeats)      IR1: 62..70, 71..79  (AACCCTTTC..GACAGGGTT)
  IR2: 143..150, 154..161  (TGGCCTGC..GGAGGCCA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 551 nt

>oriT_pSH111_166
TGTAAAGAGGCTGTGAAAGAATAAGAGCATCAAGATTCCAGATAGATAGAGGGAAATTTGACAAATTCCAAAGATGGGTTAGCCTAGTGACAGAACTAGATTCCAGTATTGGAATAATCAGCTTTAAATTCCAGATAGATAGTTATGTGGATAGGAATTGGATAGGAATTGGGAGGGTATTGAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   540 GenBank   YP_006956973
Name   TraI_pSH111_166 insolico UniProt ID   H9TK29
Length   990 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 990 a.a.        Molecular weight: 109356.90 Da        Isoelectric Point: 4.9395

>YP_006956973.1 TraI, Conjugative transfer protein TraI, relaxase (plasmid) [Salmonella enterica subsp. enterica serovar Heidelberg]
MLKALNKLFGGRSGVIETAPSVRVLPLKDVEDEEIPRYPPFAKGLPVAPLDKILATQAELIEKVRNSLGF
TVDDFNRLVLPVIQRYAAFVHLLPASESHHHRGAGGLFRHGLEVAFWAAQASESVIFSIEGTPRERRDNE
PRWRLASCFSGLLHDVGKPLSDVSITDKDGSITWNPYSESLHDWAHRHEIDRYFIRWRDKRHKRHEQFSL
LAVDRIIPAETREFLSKSGPSIMEAMLEAISGTSVNQPVTKLMLRADQESVSRDLRQSRLDVDEFSYGVP
VERYVFDAIRRLVKTGKWKVNEPGAKVWHLNQGVFIAWKQLGDLYDLISHDKIPGIPRDPDTLADILIER
GFAVPNTVQEKGERAYYRYWEVLPEMLQEAAGSVKILMLRLESNDLVFTTEPPAAVAAEVVGDVEDAEIE
FVDPEEVDDDQEEDVSALNDDMLAAEQEAEKALAGLGFGDAMEMLKSTSDAVEEKPEQKDAGSTESSKPD
AGKKGKPQSKPGKAKPKSDTEKQPHKPEAKEDLSPQDIAKNAPPLANDNPLQALKDVGGGLGDIDFPFDA
FSASAETASTDATNSEIPDVAMPGKQEKQPKQDFVPQEQNSLQGDDFPMFGSSDEPPSWAIEPLPMLTDA
PEQTTPAPAMPPTDKPNLHEKDAKTLLVEMLAGYGEASALLEQAIMPVLEGKTTLGEVLCLMKGQAVILY
PDGARSLGAPSEVLSKLSHANAIVPDPIMPGRKVRDFSGVKAIVLAEQLSDAVVAAIKDAEASMGGYQDA
FELVSPPGLDASKNKSAPKQQSRKKAQQQKPEVNAGKPSPEQKAKGKDSQPQQKEKKVDVTSPVEEPQRQ
PVQEKQNVARLPKREVQPVAPEPKVEREKELGHVEVREREEPEVREFEPPKAKTNPKDINAEDFLPSGVT
PQKALQMLKDMIQKRSGRWLVTPVLEEDGCLVTSDKAFDMIAGENIGISKHILCGMLSRAQRRPLLKKRQ
GKLYLEVNET

  Protein domains


Predicted by InterproScan.

Putative helicase (TraI_2)

(51-357)


  Protein structure


Source ID Structure
AlphaFold DB H9TK29


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 110546..119636

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HS843_RS00625 105571..105936 - 366 Protein_124 LuxR family transcriptional regulator -
HS843_RS00630 (pSH111_166_130) 106193..106510 + 318 WP_000118520 quaternary ammonium compound efflux SMR transporter SugE -
HS843_RS00635 (pSH111_166_131) 106507..107040 - 534 WP_001221666 lipocalin family protein -
HS843_RS00640 (pSH111_166_132) 107134..108279 - 1146 WP_000976514 extended-spectrum class C beta-lactamase CMY-2 -
HS843_RS00645 (pSH111_166_134) 108603..109865 - 1263 WP_000608644 IS1380-like element ISEcp1 family transposase -
HS843_RS00650 (pSH111_166_135) 110150..110542 - 393 WP_000479535 TraA family conjugative transfer protein -
HS843_RS00655 (pSH111_166_136) 110546..111124 - 579 WP_000793435 type IV conjugative transfer system lipoprotein TraV traV
HS843_RS00660 (pSH111_166_137) 111121..112434 - 1314 WP_024131605 TraB/VirB10 family protein traB
HS843_RS00665 (pSH111_166_138) 112434..113351 - 918 WP_000794249 type-F conjugative transfer system secretin TraK traK
HS843_RS00670 (pSH111_166_139) 113335..113961 - 627 WP_001049717 TraE/TraK family type IV conjugative transfer system protein traE
HS843_RS00675 (pSH111_166_140) 113958..114239 - 282 WP_000805625 type IV conjugative transfer system protein TraL traL
HS843_RS00680 (pSH111_166_141) 114384..114749 - 366 WP_001052530 hypothetical protein -
HS843_RS00685 (pSH111_166_142) 114761..114904 - 144 WP_001275801 hypothetical protein -
HS843_RS00690 (pSH111_166_143) 115085..115747 - 663 WP_001231464 hypothetical protein -
HS843_RS00695 (pSH111_166_144) 115747..116124 - 378 WP_000869297 hypothetical protein -
HS843_RS00700 116134..116580 - 447 WP_000122507 hypothetical protein -
HS843_RS00705 (pSH111_166_146) 116590..117219 - 630 WP_000743449 DUF4400 domain-containing protein tfc7
HS843_RS00710 (pSH111_166_147) 117176..117760 - 585 WP_000332868 hypothetical protein -
HS843_RS00715 (pSH111_166_148) 117771..119636 - 1866 WP_000178857 conjugative transfer system coupling protein TraD virb4
HS843_RS00720 (pSH111_166_149) 119633..122605 - 2973 WP_001326173 MobH family relaxase -
HS843_RS00725 (pSH111_166_150) 122773..123390 + 618 WP_001249395 hypothetical protein -
HS843_RS00730 (pSH111_166_151) 123372..123605 + 234 WP_001191890 hypothetical protein -

Host bacterium

ID   930 GenBank   NC_019121
Plasmid name   pSH111_166 Incompatibility group   IncA/C2
Plasmid size   165791 bp Coordinate of oriT [Strand]   117220..117770 [-]
Host baterium   Salmonella enterica subsp. enterica serovar Heidelberg

Cargo genes

Drug resistance gene   blaCMY-2, sul2, aph(3'')-Ib, aph(6)-Id, tet(A), floR, aph(4)-Ia, aac(3)-IVa
Virulence gene   -
Metal resistance gene   merR, merT, merP, merA, merB, merD, merE
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -