Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 100424 |
| Name | oriT_pWTk445 |
| Organism | Advenella kashmirensis WT001 |
| Sequence Completeness | core |
| NCBI accession of oriT (coordinates [strand]) | NC_017965 (40198..40249 [-], 52 nt) |
| oriT length | 52 nt |
| IRs (inverted repeats) | 17..25, 31..39 (ATAGGGTAC..GCTCGCTAT) |
| Location of nic site | 49..50 |
| Conserved sequence flanking the nic site |
ATCCCTG|A |
| Note | predicted by the oriTfinder |
oriT sequence
Download Length: 52 nt
>oriT_pWTk445
AGCCTTTAAAGCGAAAATAGGGTACTCCATGCTCGCTATATCATCCCTGACA
AGCCTTTAAAGCGAAAATAGGGTACTCCATGCTCGCTATATCATCCCTGACA
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Relaxase
| ID | 495 | GenBank | WP_014752712 |
| Name | PutativerelaxaseofpWTk445 |
UniProt ID | I3UHY4 |
| Length | 339 a.a. | PDB ID | |
| Note | putative relaxase | ||
Relaxase protein sequence
Download Length: 339 a.a. Molecular weight: 38719.50 Da Isoelectric Point: 10.7057
>WP_014752712.1 relaxase/mobilization nuclease domain-containing protein [Advenella kashmirensis]
MKQLDQQVDKWFMEFKTRSIRPKPGAAGRGAMRRPLKPGTGLKNIQSAALKKPEVMVKIPPRKGGSNGIQ
AVRGHMDYISRNGTLDLEDQDGLIYKGQKQIHEGITNAWKALGVPEKSTKREAINLVLSMPPGTNPEAVK
AAAREFAKEEFDGHQYAFVQHLDEKHPHVHLCVMMKHELGRRMDPRKADLFEWRLRFAEKMREQGVDCAA
TRRVHRGKTQKPEHSALRHMRKRGQVPNVYRQQAIELAQAVKGSTRPIHPFLREEIRTRNIVSTEYGKIA
KELYKIGAKAEARVLSGFAKEIKLEGHTTQAQQRFEQAQGQIHEKTREDFSAHDKNIER
MKQLDQQVDKWFMEFKTRSIRPKPGAAGRGAMRRPLKPGTGLKNIQSAALKKPEVMVKIPPRKGGSNGIQ
AVRGHMDYISRNGTLDLEDQDGLIYKGQKQIHEGITNAWKALGVPEKSTKREAINLVLSMPPGTNPEAVK
AAAREFAKEEFDGHQYAFVQHLDEKHPHVHLCVMMKHELGRRMDPRKADLFEWRLRFAEKMREQGVDCAA
TRRVHRGKTQKPEHSALRHMRKRGQVPNVYRQQAIELAQAVKGSTRPIHPFLREEIRTRNIVSTEYGKIA
KELYKIGAKAEARVLSGFAKEIKLEGHTTQAQQRFEQAQGQIHEKTREDFSAHDKNIER
Protein domains
Predicted by InterproScan.
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | I3UHY4 |
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 20306..31077
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| TKWG_RS20645 (TKWG_25604) | 17795..19723 | - | 1929 | WP_014752718 | type IV secretory system conjugative DNA transfer family protein | - |
| TKWG_RS20650 (TKWG_25609) | 19762..20178 | - | 417 | WP_171815220 | single-stranded DNA-binding protein | - |
| TKWG_RS20655 (TKWG_25614) | 20306..21418 | - | 1113 | WP_014752720 | ATPase, T2SS/T4P/T4SS family | virB11 |
| TKWG_RS20660 (TKWG_25619) | 21428..22633 | - | 1206 | WP_014752721 | type IV secretion system protein VirB10 | virB10 |
| TKWG_RS20665 (TKWG_25624) | 22644..23468 | - | 825 | WP_014752722 | P-type conjugative transfer protein VirB9 | virB9 |
| TKWG_RS20670 (TKWG_25629) | 23512..24204 | - | 693 | WP_014752723 | type IV secretion system protein | virB8 |
| TKWG_RS23790 (TKWG_25634) | 24194..24337 | - | 144 | WP_014752724 | hypothetical protein | - |
| TKWG_RS20680 (TKWG_25644) | 24833..25774 | - | 942 | WP_014752726 | type IV secretion system protein | virB6 |
| TKWG_RS20685 (TKWG_25649) | 25801..26088 | - | 288 | WP_014752727 | hypothetical protein | - |
| TKWG_RS20690 (TKWG_25654) | 26173..26814 | - | 642 | WP_014752728 | type IV secretion system protein | virB5 |
| TKWG_RS26770 | 26918..27775 | - | 858 | WP_322786649 | hypothetical protein | virb4 |
| TKWG_RS26775 | 27772..29298 | - | 1527 | WP_322786650 | hypothetical protein | virb4 |
| TKWG_RS20700 (TKWG_25669) | 29207..29638 | - | 432 | WP_014752729 | VirB3 family type IV secretion system protein | virB3 |
| TKWG_RS20705 (TKWG_25674) | 29657..29980 | - | 324 | WP_041710590 | TrbC/VirB2 family protein | virB2 |
| TKWG_RS20715 (TKWG_25679) | 30313..31077 | - | 765 | WP_238534459 | lytic transglycosylase domain-containing protein | virB1 |
| TKWG_RS20720 (TKWG_25684) | 31080..31493 | - | 414 | WP_014752732 | hypothetical protein | - |
| TKWG_RS20725 (TKWG_25689) | 31548..32144 | - | 597 | WP_014752733 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| TKWG_RS20730 (TKWG_25694) | 32110..32874 | - | 765 | WP_014752734 | hypothetical protein | - |
| TKWG_RS20735 (TKWG_25699) | 32920..33435 | - | 516 | WP_014752735 | hypothetical protein | - |
| TKWG_RS20740 (TKWG_25704) | 33924..34271 | - | 348 | WP_032492227 | helix-turn-helix transcriptional regulator | - |
| TKWG_RS22885 (TKWG_25709) | 34384..34623 | + | 240 | WP_014752737 | Cro/CI family transcriptional regulator | - |
| TKWG_RS20745 (TKWG_25714) | 35146..35511 | - | 366 | WP_032492226 | hypothetical protein | - |
Host bacterium
| ID | 885 | GenBank | NC_017965 |
| Plasmid name | pWTk445 | Incompatibility group | _ |
| Plasmid size | 57884 bp | Coordinate of oriT [Strand] | 40198..40249 [-] |
| Host baterium | Advenella kashmirensis WT001 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | VOC family virulence protein |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |