Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100423
Name   oriT_plasmid1_DO in_silico
Organism   Enterococcus faecium DO
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NC_017961 (23823..24037 [+], 215 nt)
oriT length   215 nt
IRs (inverted repeats)      61..76, 80..95  (ACTTAACCCCCCGTAT..ACAGGGGGGTACAAAT)
  123..134, 139..150  (GAAAATCCTTTG..CAAGGGATTTAC)
Location of nic site      135..136
Conserved sequence flanking the
  nic site  
 
 TGG|T
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 215 nt

>oriT_plasmid1_DO
AAGCGGAAGTCGCAGGTGTGGACTGATCTTGCTGGCTGGTGTGGCAATAGCCACGCCAGCACTTAACCCCCCGTATCTAACAGGGGGGTACAAATCGACAGGAAACAGTCAAAAAAACATTAGAAAATCCTTTGGTTACAAGGGATTTACAAAATTTCAGCGTATGTCAAATGGGCTTTAAAAGTTGACATACGCCTTTTTGATTGGAGGGATTT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   494 GenBank   YP_006377333
Name   Pre_plasmid1_DO insolico UniProt ID   Q3Y252
Length   420 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 420 a.a.        Molecular weight: 49660.33 Da        Isoelectric Point: 9.9693

>YP_006377333.1 plasmid recombinase enzyme Pre (plasmid) [Enterococcus faecium DO]
MSYAVCRMQKVKSAGLKGMQFHNQRERKSRTNDDIDHERTRENYDLKNDKNIDYNERVKEIIESQKTGTR
KTRKDAVLVNELLVTSDRDFFEQLDPGEQKRFFEESYKLFSERYGKQNIAYATVHNDEQTPHMHLGVVPM
RDGKLQGKNVFNRQELLWLQDKFPEHMKKQGFELKRGERGSDRKHIETAKFKKQTLEKEIDFLEKNLAVK
KDEWTAYSDKVKSDLEVPAKRHMKSVEVPTGEKSMFGLGKEIMKTEKKPTKNVVISERDYKNLVTAARDN
DRLKQHVRNLMSTDMAREYKKLSKEHGQVKEKYSGLVERFNENVNDYNELLEENKSLKSKISDLKRDVSL
IYESTKEFLKERTDGLKAFKNVFKGFVDKVKDKTAQFQEKHDLEPKKNEFELTHNREVKKERSRDQGMSL

  Protein domains


Predicted by InterproScan.

(1-193)


  Protein structure


Source ID Structure
AlphaFold DB Q3Y252


T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 21718..35886

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HMPREF0351_RS13140 (HMPREF0351_12728) 18022..18921 + 900 WP_025192414 protein rep -
HMPREF0351_RS13145 (HMPREF0351_12729) 18944..19624 - 681 WP_002328852 IS6-like element IS1216 family transposase -
HMPREF0351_RS13150 (HMPREF0351_12730) 19782..20404 - 623 Protein_19 recombinase family protein -
HMPREF0351_RS13155 (HMPREF0351_12731) 20675..21187 - 513 WP_000774078 hypothetical protein -
HMPREF0351_RS13160 (HMPREF0351_12734) 21718..22032 + 315 WP_000420682 YdcP family protein orf23
HMPREF0351_RS13165 (HMPREF0351_12735) 22048..22434 + 387 WP_000985015 YdcP family protein orf23
HMPREF0351_RS13170 (HMPREF0351_12736) 22463..23848 + 1386 WP_000813488 FtsK/SpoIIIE domain-containing protein virb4
HMPREF0351_RS13175 (HMPREF0351_12737) 23851..24003 + 153 WP_000879507 hypothetical protein -
HMPREF0351_RS13180 (HMPREF0351_12738) 24026..25231 + 1206 WP_000398284 MobT family relaxase -
HMPREF0351_RS13185 (HMPREF0351_12739) 26015..27925 + 1911 WP_002286940 group II intron reverse transcriptase/maturase -
HMPREF0351_RS13190 (HMPREF0351_12740) 28029..28253 + 225 WP_032509114 hypothetical protein orf19
HMPREF0351_RS13195 (HMPREF0351_12741) 28370..28867 + 498 WP_000342539 antirestriction protein ArdA -
HMPREF0351_RS13200 (HMPREF0351_12742) 28956..29348 + 393 WP_000723888 conjugal transfer protein orf17a
HMPREF0351_RS13205 (HMPREF0351_12743) 29332..31779 + 2448 WP_000331160 ATP-binding protein virb4
HMPREF0351_RS13210 (HMPREF0351_12744) 31782..33959 + 2178 WP_014748747 YtxH domain-containing protein orf15
HMPREF0351_RS13215 (HMPREF0351_12745) 33956..34957 + 1002 WP_001574272 bifunctional lysozyme/C40 family peptidase orf14
HMPREF0351_RS13220 (HMPREF0351_12746) 34954..35886 + 933 WP_001224319 conjugal transfer protein orf13
HMPREF0351_RS13225 36131..36247 + 117 WP_001791010 tetracycline resistance determinant leader peptide -


Host bacterium


ID   884 GenBank   NC_017961
Plasmid name   plasmid1_DO Incompatibility group   _
Plasmid size   36262 bp Coordinate of oriT [Strand]   23823..24037 [+]
Host baterium   Enterococcus faecium DO

Cargo genes


Drug resistance gene   tetracycline resistance
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -