Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100418
Name   oriT_pCol1B9_SL1344 in_silico
Organism   Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NC_017718 (33864..33966 [-], 103 nt)
oriT length   103 nt
IRs (inverted repeats)      IR1: 19..26, 30..37  (GTCGGGGC..GCCCTGAC)
 IR2: 44..58, 67..81  (GCAATTGTATAATCG..CGGTTATACAATTGC)
Location of nic site      89..90
Conserved sequence flanking the
  nic site  
 
 CATCCTG|T
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 103 nt

>oriT_pCol1B9_SL1344
TCAGCTCCTTACTGGGGTGTCGGGGCGAAGCCCTGACCAGGAGGCAATTGTATAATCGCGCGTGCGCGGTTATACAATTGCACATCCTGTCCCGTTTTTCAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   489 GenBank   WP_001354015
Name   NikB_pCol1B9_SL1344 insolico UniProt ID   _
Length   899 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 104018.47 Da        Isoelectric Point: 7.3526

>WP_001354015.1 MULTISPECIES: IncI1-type relaxase NikB [Enterobacteriaceae]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVHDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCLAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPENRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDKSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG

  Protein domains


Predicted by InterproScan.

(62-314)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 39332..76801

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SL1344_RS24445 (SL1344_P2_0050) 37048..39339 - 2292 WP_014653261 F-type conjugative transfer protein TrbC -
SL1344_RS24450 (SL1344_P2_0051) 39332..40402 - 1071 WP_000151583 IncI1-type conjugal transfer protein TrbB trbB
SL1344_RS24455 (SL1344_P2_0052) 40421..41629 - 1209 WP_000121274 IncI1-type conjugal transfer protein TrbA trbA
SL1344_RS24460 (SL1344_P2_0054) 41921..42073 + 153 WP_001331364 Hok/Gef family protein -
SL1344_RS24465 42145..42396 - 252 WP_001291965 hypothetical protein -
SL1344_RS27945 42897..42992 + 96 WP_000609148 DinQ-like type I toxin DqlB -
SL1344_RS27555 43057..43233 - 177 WP_001054904 hypothetical protein -
SL1344_RS24475 43625..43834 + 210 WP_000062603 HEAT repeat domain-containing protein -
SL1344_RS24480 (SL1344_P2_0055) 43906..44568 - 663 WP_000653334 plasmid IncI1-type surface exclusion protein ExcA -
SL1344_RS24485 (SL1344_P2_0056) 44633..46795 - 2163 WP_000698351 DotA/TraY family protein traY
SL1344_RS24490 (SL1344_P2_0057) 46892..47476 - 585 WP_001037987 IncI1-type conjugal transfer protein TraX -
SL1344_RS24495 (SL1344_P2_0058) 47505..48707 - 1203 WP_001189161 IncI1-type conjugal transfer protein TraW traW
SL1344_RS26425 (SL1344_P2_0059) 48674..49288 - 615 WP_000337399 IncI1-type conjugal transfer protein TraV traV
SL1344_RS24500 (SL1344_P2_0060) 49288..52332 - 3045 WP_001024779 IncI1-type conjugal transfer protein TraU traU
SL1344_RS24505 (SL1344_P2_0061) 52422..53222 - 801 WP_001164788 IncI1-type conjugal transfer protein TraT traT
SL1344_RS24510 (SL1344_P2_0062) 53206..53394 - 189 WP_001277255 putative conjugal transfer protein TraS -
SL1344_RS24515 (SL1344_P2_0063) 53458..53862 - 405 WP_000086957 IncI1-type conjugal transfer protein TraR traR
SL1344_RS24520 (SL1344_P2_0064) 53913..54440 - 528 WP_001055569 conjugal transfer protein TraQ traQ
SL1344_RS24525 (SL1344_P2_0065) 54440..55144 - 705 WP_000801920 IncI1-type conjugal transfer protein TraP traP
SL1344_RS24530 (SL1344_P2_0066) 55144..56433 - 1290 WP_001272005 conjugal transfer protein TraO traO
SL1344_RS24535 (SL1344_P2_0067) 56436..57419 - 984 WP_001191877 IncI1-type conjugal transfer protein TraN traN
SL1344_RS24540 (SL1344_P2_0068) 57430..58122 - 693 WP_000138548 DotI/IcmL family type IV secretion protein traM
SL1344_RS24545 (SL1344_P2_0069) 58119..58466 - 348 WP_001055900 conjugal transfer protein traL
SL1344_RS24550 (SL1344_P2_0071) 58484..62251 - 3768 WP_001141529 LPD7 domain-containing protein -
SL1344_RS24555 (SL1344_P2_0072) 62341..62892 - 552 WP_000014583 phospholipase D family protein -
SL1344_RS26430 (SL1344_P2_0073) 62907..63197 - 291 WP_001299214 hypothetical protein traK
SL1344_RS24560 (SL1344_P2_0074) 63194..64342 - 1149 WP_001024972 plasmid transfer ATPase TraJ virB11
SL1344_RS24565 (SL1344_P2_0075) 64339..65157 - 819 WP_000646098 IncI1-type conjugal transfer lipoprotein TraI traI
SL1344_RS24570 (SL1344_P2_0076) 65154..65612 - 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
SL1344_RS24575 (SL1344_P2_0077) 66007..66591 - 585 WP_000977522 histidine phosphatase family protein -
SL1344_RS24580 (SL1344_P2_0078) 66651..67853 - 1203 WP_000976351 conjugal transfer protein TraF -
SL1344_RS24585 (SL1344_P2_0079) 67938..68762 - 825 WP_001238939 conjugal transfer protein TraE traE
SL1344_RS24590 (SL1344_P2_0080) 68913..70067 - 1155 WP_001139957 site-specific integrase -
SL1344_RS27340 (SL1344_P2_0083) 70758..71006 + 249 WP_001349157 hypothetical protein -
SL1344_RS24600 (SL1344_P2_0085) 71003..72295 - 1293 WP_001417545 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
SL1344_RS26440 (SL1344_P2_0086) 72295..72951 - 657 WP_001193553 prepilin peptidase -
SL1344_RS24605 (SL1344_P2_0087) 72936..73496 - 561 WP_000014116 lytic transglycosylase domain-containing protein virB1
SL1344_RS24610 (SL1344_P2_0088) 73506..74120 - 615 WP_000959785 type 4 pilus major pilin -
SL1344_RS24615 (SL1344_P2_0089) 74138..75235 - 1098 WP_001208805 type II secretion system F family protein -
SL1344_RS24620 (SL1344_P2_0090) 75248..76801 - 1554 WP_000362202 ATPase, T2SS/T4P/T4SS family virB11
SL1344_RS24625 (SL1344_P2_0091) 76812..77264 - 453 WP_001247336 type IV pilus biogenesis protein PilP -
SL1344_RS24630 (SL1344_P2_0092) 77251..78546 - 1296 WP_000752774 type 4b pilus protein PilO2 -
SL1344_RS24635 (SL1344_P2_0093) 78539..80221 - 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
SL1344_RS24640 (SL1344_P2_0094) 80235..80672 - 438 WP_000539807 type IV pilus biogenesis protein PilM -
SL1344_RS24645 (SL1344_P2_0095) 80672..81739 - 1068 WP_000742600 type IV pilus biogenesis lipoprotein PilL -


Host bacterium


ID   879 GenBank   NC_017718
Plasmid name   pCol1B9_SL1344 Incompatibility group   IncI1
Plasmid size   86908 bp Coordinate of oriT [Strand]   33864..33966 [-]
Host baterium   Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -