Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100416
Name   oriT_pRK1 in_silico
Organism   Escherichia coli W
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NC_017665 (5704..5813 [-], 110 nt)
oriT length   110 nt
IRs (inverted repeats)      IR1: 24..31, 35..42  (GTCGGGGC..GCCCTGAC)
 IR2: 49..65, 72..88  (GCAATTGTAATAGCGTC..GACGGTATTACAATTGC)
Location of nic site      96..97
Conserved sequence flanking the
  nic site  
 
 CATCCTG|T
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 110 nt

>oriT_pRK1
TCACTTCAGGCTCCTTACGGGGTGTCGGGGCGAAGCCCTGACCAGATGGCAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTGCACATCCTGTCCCGTTTTTCAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   487 GenBank   WP_001350015
Name   NikB_pRK1 insolico UniProt ID   _
Length   899 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 104034.43 Da        Isoelectric Point: 7.3526

>WP_001350015.1 MULTISPECIES: IncI1-type relaxase NikB [Enterobacteriaceae]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVHDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCQAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPESRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDRSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG

  Protein domains


Predicted by InterproScan.

(62-314)


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 11173..47076

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
WFL_RS24505 (WFL_23485) 8889..11180 - 2292 WP_001289276 F-type conjugative transfer protein TrbC -
WFL_RS24510 (WFL_23490) 11173..12243 - 1071 WP_000151587 IncI1-type conjugal transfer protein TrbB trbB
WFL_RS24515 (WFL_23495) 12262..13470 - 1209 WP_000121272 IncI1-type conjugal transfer protein TrbA trbA
WFL_RS24520 (WFL_23500) 13732..14640 - 909 WP_000055084 hypothetical protein -
WFL_RS28285 (WFL_23505) 15272..15367 + 96 WP_001303310 DinQ-like type I toxin DqlB -
WFL_RS27865 (WFL_23510) 15432..15608 - 177 WP_001054904 hypothetical protein -
WFL_RS24540 (WFL_23515) 15818..16009 - 192 WP_001147208 hemolysin expression modulator Hha -
WFL_RS24545 (WFL_23520) 16075..16689 - 615 WP_000578649 plasmid IncI1-type surface exclusion protein ExcA -
WFL_RS24550 (WFL_23525) 16765..18933 - 2169 WP_000698360 IncI1-type conjugal transfer membrane protein TraY traY
WFL_RS24555 (WFL_23530) 19030..19614 - 585 WP_001037990 IncI1-type conjugal transfer protein TraX -
WFL_RS24560 (WFL_23535) 19643..20845 - 1203 WP_001189156 IncI1-type conjugal transfer protein TraW traW
WFL_RS24565 (WFL_23540) 20812..21426 - 615 WP_000337400 IncI1-type conjugal transfer protein TraV traV
WFL_RS24570 (WFL_23545) 21426..24470 - 3045 WP_001024787 IncI1-type conjugal transfer protein TraU traU
WFL_RS24575 (WFL_23550) 24560..25360 - 801 WP_001164788 IncI1-type conjugal transfer protein TraT traT
WFL_RS24580 (WFL_23555) 25344..25532 - 189 WP_001277255 putative conjugal transfer protein TraS -
WFL_RS24585 (WFL_23560) 25596..26000 - 405 WP_000086960 IncI1-type conjugal transfer protein TraR traR
WFL_RS24590 (WFL_23565) 26051..26578 - 528 WP_001055569 conjugal transfer protein TraQ traQ
WFL_RS24595 (WFL_23570) 26578..27282 - 705 WP_000801920 IncI1-type conjugal transfer protein TraP traP
WFL_RS24600 (WFL_23575) 27282..28571 - 1290 WP_001271991 conjugal transfer protein TraO traO
WFL_RS24605 (WFL_23580) 28574..29557 - 984 WP_001191878 IncI1-type conjugal transfer protein TraN traN
WFL_RS24610 (WFL_23585) 29568..30260 - 693 WP_000138549 DotI/IcmL family type IV secretion protein traM
WFL_RS24615 (WFL_23590) 30257..30604 - 348 WP_001055900 conjugal transfer protein traL
WFL_RS24620 (WFL_23595) 30622..34389 - 3768 WP_001141538 LPD7 domain-containing protein -
WFL_RS24625 (WFL_23600) 34479..35030 - 552 WP_000014584 phospholipase D family protein -
WFL_RS26630 35045..35335 - 291 WP_001299214 hypothetical protein traK
WFL_RS24630 (WFL_23610) 35332..36480 - 1149 WP_001024972 plasmid transfer ATPase TraJ virB11
WFL_RS24635 (WFL_23615) 36477..37295 - 819 WP_000646097 IncI1-type conjugal transfer lipoprotein TraI traI
WFL_RS24640 (WFL_23620) 37292..37750 - 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
WFL_RS24645 (WFL_23625) 38145..38729 - 585 WP_000977526 histidine phosphatase family protein -
WFL_RS24650 (WFL_23630) 38789..39991 - 1203 WP_000976350 conjugal transfer protein TraF -
WFL_RS24655 (WFL_23635) 40077..40901 - 825 WP_001238943 conjugal transfer protein TraE traE
WFL_RS27215 41109..41234 + 126 Protein_42 RNA-guided endonuclease TnpB family protein -
WFL_RS24660 (WFL_23640) 41291..42583 - 1293 WP_001350014 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
WFL_RS24665 (WFL_23645) 42583..43239 - 657 WP_001193549 A24 family peptidase -
WFL_RS24670 (WFL_23650) 43224..43784 - 561 WP_000014005 lytic transglycosylase domain-containing protein virB1
WFL_RS24675 (WFL_23655) 43794..44408 - 615 WP_000908226 type 4 pilus major pilin -
WFL_RS24680 (WFL_23660) 44425..45510 - 1086 WP_001208804 type II secretion system F family protein -
WFL_RS24685 (WFL_23665) 45523..47076 - 1554 WP_000362206 ATPase, T2SS/T4P/T4SS family virB11
WFL_RS24690 (WFL_23670) 47087..47539 - 453 WP_001236383 type IV pilus biogenesis protein PilP -
WFL_RS24695 (WFL_23675) 47526..48821 - 1296 WP_000752792 type 4b pilus protein PilO2 -
WFL_RS24700 (WFL_23680) 48814..50496 - 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
WFL_RS24705 (WFL_23685) 50510..50947 - 438 WP_000539807 type IV pilus biogenesis protein PilM -
WFL_RS24710 50947..52014 - 1068 WP_001350013 type IV pilus biogenesis lipoprotein PilL -


Host bacterium


ID   877 GenBank   NC_017665
Plasmid name   pRK1 Incompatibility group   IncI
Plasmid size   102535 bp Coordinate of oriT [Strand]   5704..5813 [-]
Host baterium   Escherichia coli W

Cargo genes


Drug resistance gene   -
Virulence gene   faeC, faeD, faeE, faeF, faeG
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -