Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100407
Name   oriT_pRK1 in_silico
Organism   Escherichia coli W
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NC_017637 (12719..12828 [-], 110 nt)
oriT length   110 nt
IRs (inverted repeats)      IR1: 24..31, 35..42  (GTCGGGGC..GCCCTGAC)
 IR2: 49..65, 72..88  (GCAATTGTAATAGCGTC..GACGGTATTACAATTGC)
Location of nic site      96..97
Conserved sequence flanking the
  nic site  
 
 CATCCTG|T
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 110 nt

>oriT_pRK1
TCACTTCAGGCTCCTTACGGGGTGTCGGGGCGAAGCCCTGACCAGATGGCAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTGCACATCCTGTCCCGTTTTTCAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   478 GenBank   WP_001350015
Name   NikB_pRK1 insolico UniProt ID   E0J389
Length   899 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 104034.43 Da        Isoelectric Point: 7.3526

>WP_001350015.1 MULTISPECIES: IncI1-type relaxase NikB [Enterobacteriaceae]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVHDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCQAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPESRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDRSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG

  Protein domains


Predicted by InterproScan.

(62-314)


  Protein structure


Source ID Structure
AlphaFold DB E0J389


T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 18188..54091

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECW_RS24600 (ECW_P1m0020) 15904..18195 - 2292 WP_001289276 F-type conjugative transfer protein TrbC -
ECW_RS24605 (ECW_P1m0021) 18188..19258 - 1071 WP_000151587 IncI1-type conjugal transfer protein TrbB trbB
ECW_RS24610 (ECW_P1m0022) 19277..20485 - 1209 WP_000121272 IncI1-type conjugal transfer protein TrbA trbA
ECW_RS24615 (ECW_P1m0023) 20747..21655 - 909 WP_000055084 hypothetical protein -
ECW_RS28490 22287..22382 + 96 WP_001303310 DinQ-like type I toxin DqlB -
ECW_RS28065 (ECW_P1m0025) 22447..22623 - 177 WP_001054904 hypothetical protein -
ECW_RS24635 22833..23024 - 192 WP_001147208 hemolysin expression modulator Hha -
ECW_RS24640 (ECW_P1m0026) 23090..23704 - 615 WP_000578649 plasmid IncI1-type surface exclusion protein ExcA -
ECW_RS24645 (ECW_P1m0027) 23780..25948 - 2169 WP_000698360 IncI1-type conjugal transfer membrane protein TraY traY
ECW_RS24650 (ECW_P1m0028) 26045..26629 - 585 WP_001037990 IncI1-type conjugal transfer protein TraX -
ECW_RS24655 (ECW_P1m0029) 26658..27860 - 1203 WP_001189156 IncI1-type conjugal transfer protein TraW traW
ECW_RS24660 (ECW_P1m0030) 27827..28441 - 615 WP_000337400 IncI1-type conjugal transfer protein TraV traV
ECW_RS24665 (ECW_P1m0031) 28441..31485 - 3045 WP_001024787 IncI1-type conjugal transfer protein TraU traU
ECW_RS24670 (ECW_P1m0032) 31575..32375 - 801 WP_001164788 IncI1-type conjugal transfer protein TraT traT
ECW_RS24675 (ECW_P1m0033) 32359..32547 - 189 WP_001277255 putative conjugal transfer protein TraS -
ECW_RS24680 (ECW_P1m0034) 32611..33015 - 405 WP_000086960 IncI1-type conjugal transfer protein TraR traR
ECW_RS24685 (ECW_P1m0035) 33066..33593 - 528 WP_001055569 conjugal transfer protein TraQ traQ
ECW_RS24690 (ECW_P1m0036) 33593..34297 - 705 WP_000801920 IncI1-type conjugal transfer protein TraP traP
ECW_RS24695 (ECW_P1m0037) 34297..35586 - 1290 WP_001271991 conjugal transfer protein TraO traO
ECW_RS24700 (ECW_P1m0038) 35589..36572 - 984 WP_001191878 IncI1-type conjugal transfer protein TraN traN
ECW_RS24705 (ECW_P1m0039) 36583..37275 - 693 WP_000138549 DotI/IcmL family type IV secretion protein traM
ECW_RS24710 (ECW_P1m0040) 37272..37619 - 348 WP_001055900 conjugal transfer protein traL
ECW_RS24715 (ECW_P1m0041) 37637..41404 - 3768 WP_001141538 LPD7 domain-containing protein -
ECW_RS24720 (ECW_P1m0043) 41494..42045 - 552 WP_000014584 phospholipase D family protein -
ECW_RS26795 (ECW_P1m0044) 42060..42350 - 291 WP_001299214 hypothetical protein traK
ECW_RS24725 (ECW_P1m0045) 42347..43495 - 1149 WP_001024972 plasmid transfer ATPase TraJ virB11
ECW_RS24730 (ECW_P1m0046) 43492..44310 - 819 WP_000646097 IncI1-type conjugal transfer lipoprotein TraI traI
ECW_RS24735 (ECW_P1m0047) 44307..44765 - 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
ECW_RS24740 (ECW_P1m0048) 45160..45744 - 585 WP_000977526 histidine phosphatase family protein -
ECW_RS24745 (ECW_P1m0049) 45804..47006 - 1203 WP_000976350 conjugal transfer protein TraF -
ECW_RS24750 (ECW_P1m0050) 47092..47916 - 825 WP_001238943 conjugal transfer protein TraE traE
ECW_RS27370 48124..48249 + 126 Protein_50 RNA-guided endonuclease TnpB family protein -
ECW_RS24755 (ECW_P1m0051) 48306..49598 - 1293 WP_001350014 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
ECW_RS24760 (ECW_P1m0052) 49598..50254 - 657 WP_001193549 A24 family peptidase -
ECW_RS24765 (ECW_P1m0053) 50239..50799 - 561 WP_000014005 lytic transglycosylase domain-containing protein virB1
ECW_RS24770 (ECW_P1m0054) 50809..51423 - 615 WP_000908226 type 4 pilus major pilin -
ECW_RS24775 (ECW_P1m0055) 51440..52525 - 1086 WP_001208804 type II secretion system F family protein -
ECW_RS24780 (ECW_P1m0056) 52538..54091 - 1554 WP_000362206 ATPase, T2SS/T4P/T4SS family virB11
ECW_RS24785 (ECW_P1m0057) 54102..54554 - 453 WP_001236383 type IV pilus biogenesis protein PilP -
ECW_RS24790 (ECW_P1m0058) 54541..55836 - 1296 WP_000752792 type 4b pilus protein PilO2 -
ECW_RS24795 (ECW_P1m0059) 55829..57511 - 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
ECW_RS24800 (ECW_P1m0060) 57525..57962 - 438 WP_000539807 type IV pilus biogenesis protein PilM -
ECW_RS24805 (ECW_P1m0061) 57962..59029 - 1068 WP_001350013 type IV pilus biogenesis lipoprotein PilL -


Host bacterium


ID   868 GenBank   NC_017637
Plasmid name   pRK1 Incompatibility group   IncI
Plasmid size   102536 bp Coordinate of oriT [Strand]   12719..12828 [-]
Host baterium   Escherichia coli W

Cargo genes


Drug resistance gene   -
Virulence gene   faeC, faeD, faeE, faeF, faeG
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -