Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100367
Name   oriT_pWZ1668 in_silico
Organism   Enterococcus faecalis
Sequence Completeness      incomplete
NCBI accession of oriT (coordinates [strand])   NC_014475 (35503..35549 [+], 47 nt)
oriT length   47 nt
IRs (inverted repeats)      IR1: 3..10, 12..19  (CATAGAAT..ATTCTTTG)
  IR2: 25..31, 32..38  (TTCAATC..GATTCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 47 nt

>oriT_pWZ1668
GTCATAGAATAATTCTTTGTTTTCTTCAATCGATTCAATAGAAATAT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   438 GenBank   YP_003864133
Name   Nickase_pWZ1668 insolico UniProt ID   E0X5B7
Length   654 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 654 a.a.        Molecular weight: 76612.47 Da        Isoelectric Point: 9.3564

>YP_003864133.1 nickase (plasmid) [Enterococcus faecalis]
MTIAKREGGKRSLIAMASYRSGEKLYSELYEKTNLYNHRTVKPEAFILKPDYVPNEFLDRQTLWNKMELA
EKSPNAQLCREVNVALPIELNNSDQRMLIEDFVKDNFVSEGMIADVAIHRDDENNPHAHIMLTMREVDSE
GNILNKRKRIPKLDENGNQIFNEKGQRVTVSIKTNDWDRKSLVSEIRKDWADKVNQYLKDRNIDQQITEK
SHAELGKKELPTIHEGFYSKKLEDKGVISELKRKNLEIQSYNDVLSELDKLENQEKVLKQDQNFTLKFEK
TFSPLEKKELKNLSKELKIFVNDENIDKRISELKRWENSLIFNNKMEIQKQRLMLSKISSERDMLTKANE
ILDKQAERFFKKSYPSLNIDKFSNHEVRAMVNETIFRKQLLNKDQLAEVIYNERVVEKEESKKIFKEKPF
QTSRYLDSKIKQVEDSITKENNPERKEILSIKKEKLIGIKQGLIEYVQSEVERKFDKNVSIDSVIEGEML
LAKADYYKTTDFSKVEGVARFSSEEINSMLEQSKGFLTNIQTVKIPNDCQGVFFVQDSMKHIDELSPLAK
HNLKKVVNRNAYLPDSDKIELSKEIENTNKDQSQELDKDVPEKNEVTVKMFQFAKSINRLLSGNQLQKKR
NLDKLIKQTKAKENQSLQRNIPLR

  Protein domains


Predicted by InterproScan.

MobA/MobL family (MobA_MobL)

(11-235)

Nicking enzyme C-terminal middle helical domain (NES_C_h)

(282-387)


  Protein structure


Source ID Structure
AlphaFold DB E0X5B7


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 38397..47484

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HKI86_RS00195 (pWZ1668_p33) 33971..34288 + 318 WP_000415964 hypothetical protein -
HKI86_RS00200 (pWZ1668_p34) 34327..34824 + 498 WP_000874092 DnaJ domain-containing protein -
HKI86_RS00205 34858..35163 + 306 WP_000351790 hypothetical protein -
HKI86_RS00210 (pWZ1668_p35) 35186..35443 - 258 WP_000002668 hypothetical protein -
HKI86_RS00215 (pWZ1668_p36) 35446..35745 - 300 WP_000431202 hypothetical protein -
HKI86_RS00220 (pWZ1668_p37) 36058..38022 + 1965 WP_013307845 MobA/MobL family protein -
HKI86_RS00225 (pWZ1668_p38) 38046..38378 + 333 WP_000713503 CagC family type IV secretion system protein -
HKI86_RS00230 (pWZ1668_p39) 38397..38780 + 384 WP_001083514 glycosyl transferase trsC
HKI86_RS00235 (pWZ1668_p40) 38797..39426 + 630 WP_000459258 hypothetical protein -
HKI86_RS00240 (pWZ1668_p41) 39437..41398 + 1962 WP_000411529 hypothetical protein virb4
HKI86_RS00245 (pWZ1668_p42) 41412..42764 + 1353 WP_000875579 hypothetical protein trsF
HKI86_RS00250 (pWZ1668_p43) 42786..43895 + 1110 WP_000501303 lysozyme family protein orf14
HKI86_RS00255 (pWZ1668_p44) 43908..44459 + 552 WP_000393725 hypothetical protein -
HKI86_RS00260 (pWZ1668_p45) 44464..44895 + 432 WP_001085135 hypothetical protein -
HKI86_RS00265 (pWZ1668_p46) 44888..46543 + 1656 WP_000096577 VirD4-like conjugal transfer protein, CD1115 family -
HKI86_RS00270 (pWZ1668_p47) 46561..47484 + 924 WP_001013727 hypothetical protein traP

Host bacterium

ID   828 GenBank   NC_014475
Plasmid name   pWZ1668 Incompatibility group   _
Plasmid size   48365 bp Coordinate of oriT [Strand]   35503..35549 [+]
Host baterium   Enterococcus faecalis

Cargo genes

Drug resistance gene   erm(B), VanHAX
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -