Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100353
Name   oriT_pPR9 in_silico
Organism   Staphylococcus aureus
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NC_013653 (20522..20557 [+], 36 nt)
oriT length   36 nt
IRs (inverted repeats)      4..10, 14..20  (GCGAACG..CGTTCGC)
Location of nic site      31..32
Conserved sequence flanking the
  nic site    		  TAAGTGCGCC|CT
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 36 nt

>oriT_pPR9
CACGCGAACGGAACGTTCGCATAAGTGCGCCCTTAC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   424 GenBank   YP_003347965
Name   Nes_pPR9 insolico UniProt ID   D2KNY7
Length   665 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 665 a.a.        Molecular weight: 78929.92 Da        Isoelectric Point: 5.5367

>YP_003347965.1 oriT nickase Nes (plasmid) [Staphylococcus aureus]
MAMYHFQNKFVSKANGQSATAKSAYNSASRIKDFKENEFKDYSNKQCDYSEILLPNNADDKFKDREYLWN
KVHDVENRKNSQVAREIIIGLPNEFDPNSNIELAKEFAESLSNEGMIVDLNIHKINEENPHAHLLCTLRG
LDKNNEFEPKRKGNSYIRDWNTKEKHNEWRKRWENVQNKHLEKNGFSVRVSADSYKNQNIDLEPTKKEGW
KARKFEDETGQKSSISKHNESIKKRNQQKIDKMFNEVDDMKSHKLNAFSYMNKSDSTTLKNMAKDLKIYV
TPINMYEESERLYDLKQKTALITDDEDRLNKIENIEDRQRKLESINEVFEKQSKIFFDKNYPDQKLNYSD
DEKIFITRTILNDRDVLPANHELEDIVKEKRIKEAQISLNTVIGNRDISLESIEKESNFFADKLSNILEK
NNLSFDDVLENKHEGMEDSLKIDYYTNKLEVLRNAENTLEDYYDVQIKELFTDDEDYKAFNEVTDIKEKQ
QLIDFKTYHGSENTLEMLETGNFIPKYSDEDRKYITEQVKLLQEKEFKPNKNQHDKFVLGAIQKKLLSEY
DFDYSDNNDLKHLYQESYEVGDEISKDNIEEFYEGNDILVDKETYNNYNKKQQAYGLVNAGLDSMIFNFN
EIFRERMPKYINHQYKGKNHSKQRHELKNKRGMHL

  Protein domains


Predicted by InterproScan.

MobA/MobL family (MobA_MobL)

(17-216)

Nicking enzyme C-terminal middle helical domain (NES_C_h)

(265-360)


  Protein structure


Source ID Structure
AlphaFold DB D2KNY7


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 26396..39480

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HS657_RS00105 (HUNSC491_pPR9_p20) 21537..22559 + 1023 WP_224684886 parM protein -
HS657_RS00110 (HUNSC491_pPR9_p21) 22562..22891 + 330 WP_000358311 recombinase -
HS657_RS00115 (HUNSC491_pPR9_p22) 22895..23155 - 261 WP_001008214 helix-turn-helix transcriptional regulator -
HS657_RS00215 (HUNSC491_pPR9_p23) 23537..24562 + 1026 WP_012896704 replication initiator protein -
HS657_RS00125 (HUNSC491_pPR9_p24) 24667..24855 - 189 WP_012263508 hypothetical protein -
HS657_RS00130 (HUNSC491_pPR9_p25) 25028..26002 + 975 WP_012896705 conjugative transfer protein TrsA -
HS657_RS00135 (HUNSC491_pPR9_p26) 26019..26336 + 318 WP_012896706 CagC family type IV secretion system protein -
HS657_RS00140 (HUNSC491_pPR9_p27) 26396..26803 + 408 WP_061739438 hypothetical protein trsC
HS657_RS00145 (HUNSC491_pPR9_p28) 26790..27473 + 684 WP_012263511 TrsD/TraD family conjugative transfer protein trsD
HS657_RS00150 (HUNSC491_pPR9_p29) 27488..29506 + 2019 WP_012896709 DUF87 domain-containing protein virb4
HS657_RS00155 (HUNSC491_pPR9_p30) 29518..30798 + 1281 WP_012896710 conjugal transfer protein TraF trsF
HS657_RS00160 (HUNSC491_pPR9_p31) 30816..31892 + 1077 WP_012896711 CHAP domain-containing protein trsG
HS657_RS00165 (HUNSC491_pPR9_p32) 31902..32387 + 486 WP_012896712 TrsH/TraH family protein -
HS657_RS00170 (HUNSC491_pPR9_p33) 32403..34505 + 2103 WP_012896713 DNA topoisomerase III -
HS657_RS00175 (HUNSC491_pPR9_p34) 34521..34985 + 465 WP_012896714 hypothetical protein trsJ
HS657_RS00180 (HUNSC491_pPR9_p35) 34982..36628 + 1647 WP_012896715 VirD4-like conjugal transfer protein, CD1115 family -
HS657_RS00185 (HUNSC491_pPR9_p36) 36706..37623 + 918 WP_012896716 conjugal transfer protein TrbL family protein trsL
HS657_RS00190 (HUNSC491_pPR9_p37) 37640..38032 + 393 WP_012896717 single-stranded DNA-binding protein -
HS657_RS00195 (HUNSC491_pPR9_p38) 38089..38820 + 732 WP_012896718 hypothetical protein -
HS657_RS00200 (HUNSC491_pPR9_p39) 38857..39480 + 624 WP_061739436 hypothetical protein traP
HS657_RS00205 (HUNSC491_pPR9_p40) 39496..40110 + 615 WP_012896720 hypothetical protein -
HS657_RS00210 (HUNSC491_pPR9_p41) 40179..41450 + 1272 WP_012896721 hypothetical protein -

Host bacterium

ID   814 GenBank   NC_013653
Plasmid name   pPR9 Incompatibility group   _
Plasmid size   41715 bp Coordinate of oriT [Strand]   20522..20557 [+]
Host baterium   Staphylococcus aureus

Cargo genes

Drug resistance gene   mupA, blaZ
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -