Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100343
Name   oriT_pO26_2 in_silico
Organism   Escherichia coli O26:H11 str. 11368
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NC_013362 (24230..24503 [-], 274 nt)
oriT length   274 nt
IRs (inverted repeats)      220..227, 230..237  (GCAAAAAC..GTTTTTGC)
Location of nic site      246..247
Conserved sequence flanking the
  nic site    		  GTGGGGTGT|GG
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 274 nt

>oriT_pO26_2
CGCTAGCAGCGCCCCTGACGGTATCCTATAAAAAAACACACCGCGCCGCTAGCAGCACCCCTAATATAAAATAATGTTTTTTATAAAAATAGTCAGTACCACCCCTACAAAGCGGTGTCGGCGCGTTGCTGTAGCTGCGTTAACGACGCTGCTTTAAATAAATCAGATTTAAACAATATAAATCCACAAATACAACTCAATGATATTAAAGATAAATCAGCAAAAACTTGTTTTTGCGTGGGGTGTGGTGCTTTTGGTGGTGAGAACCACCAAC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   414 GenBank   WP_000987009
Name   TraI_pO26_2 insolico UniProt ID   _
Length   1756 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 1756 a.a.        Molecular weight: 192056.90 Da        Isoelectric Point: 6.0023

>WP_000987009.1 conjugative transfer relaxase/helicase TraI [Escherichia coli]
MMSIAQVRSAGSAGNYYTDKDNYYVLGSMGERWAGRGAEQLGLQGSVDKDVFTRLLEGRLPDGADLSRMQ
DGSNRHRPGYDLTFSAPKSVSMMAMLGGDKRLIDAHNQAVDFAVRQVEALASTRVMTDGQSETVLTGNLV
MALFNHDTSRDQEPQLHTHAVVANVTQHNGEWKTLSSDKVGKTGFIENVYANQIAFGRLYREKLKEQVEA
LGYETEVVGKHGMWEMPGVPVEAFSGRSQTIREAVGEDASLKSRDVAALDTRKSKQHVDPEVRMAEWMQT
LKETGFDIRAYRDAADQRAETRTQAPGAVSQEGPDVQQAVTQAIAGLSERKVQFTYTDVLARTVGILPPE
NGVIERARAGIDEAISREQLIPLDREKGLFTSGIHVLDELSVRALSRDIMKQNRVTVHPEKSVPRTAGYS
DAVSVLAQDRPSLAIVSGQGGAAGQRERVAELVMMAREQGREVQIIAADRRSQMNLKQDERLSGELITGR
RQLLEGMAFTPGSTVIVDQGEKLSLKETLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKDAGVNTYRW
QGGEQRPATIISEPDRNVRYARLAGDFAASVKAGEESVAQVSGVREQAILTQAIRSELKTQGVLGRPEVT
MTALSPVWLDSRSRYLRDMYRPGMVMEQWNPETRSYDRYVIDRVTAQSHSLTLRDVQGETQVVRISSLDS
SWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVASVSEDAMTVVVPGRAEPASLPVSDSPFMALKL
ENGWVETPGHSVSDSAKVFASVTQMAMDNATLNGLARSGRDVRLYSSLDETRTAEKLARHPSFTVVSEQI
KARAGETLLETAISLQKAGLHTPAQQAIHLALPVVESKNLAFSHVDLLTEAKSFAAEGTSFADLGREINA
QIKRGDLLHVDVAKGYGTDLLVSRASYEAEKSILRHILEGKEAVTPLMERVPGELMEKLTSGQRAATRMI
LETPDRFTVVQGYAGVGKTTQFRAVMSAVNMLPESGRPRVVGLGPTHRAVGEMRSAGVDAQTLASFLHDT
QLQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIAAGGGRAVASGDTDQLQAIAPGQPFRLQQTRSA
ADVAIMKEIVRQTPELREAVYSLINRDVERALSGLESVKPSQVPRQEGAWAPEHSVTEFSHSQEAKLAEA
QQKAMLKGEAFPDVPMTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIHDAREKAGELGKEQVM
VPVLNTANIRDGELRRLSTWETHRDALVLVDNVYHRIAGISKDDGLITLQDAEGNTRLISPREAVAEGVT
LYTPDTIRVGTGDRMRFTKSDRERGYVANSVWTVTAVSGDSVTLSDGQQTRVIRPGQERAEQHIDLAYAI
TAHGAQGASETFAIALEGTEGNRKLMAGFESAYVALSRMKQHVQVYTDDRQGWTDAINNAVQKGTAHDVL
EPKADREVMNAERLFSTARELRDVAAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDRNGKSAG
IWLNPLTSDDGNGLRGFSGEGRVKGSGDAQFVALQGSRNGESLLADNMQDGVRIARDNPDSGVVVRIAGE
GRPWNPGAITGGRVWGDIPDNSVQPGAGNGEPVTAEVLAQRQAEEAIRRETERRADEIVRKMAENKPDLP
DGKTEQAVREIAGQERDRAAITEREAALPESVLREPQREREAVREVARENLLQERLQQMERDMVRDLQKE
KTLGGD

  Protein domains


Predicted by InterproScan.

single-stranded DNA binding TraI N-terminal subdomain (ssDNA_TraI_N)

(575-626)

AAA domain (AAA_30)

(969-1156)

DNA helicase TraI (TraI_C)

(1434-1557)

TrwC relaxase (TrwC)

(10-283)

DNA relaxase TraI 2B/2B-like domain (TraI_2B)

(633-712)


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 26563..52629

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECO26_RS35575 21664..21836 - 173 Protein_34 hypothetical protein -
ECO26_RS34950 21906..22112 + 207 WP_000547944 hypothetical protein -
ECO26_RS30330 (ECO26_p2-35) 22136..22432 + 297 WP_001272241 hypothetical protein -
ECO26_RS30335 (ECO26_p2-36) 22538..23359 + 822 WP_001234501 DUF932 domain-containing protein -
ECO26_RS30340 (ECO26_p2-37) 23657..24226 - 570 Protein_38 transglycosylase SLT domain-containing protein -
ECO26_RS30345 (ECO26_p2-38) 24580..24963 + 384 WP_001151530 conjugal transfer relaxosome DNA-binding protein TraM -
ECO26_RS30350 (ECO26_p2-39) 25155..25802 + 648 WP_000338011 transcriptional regulator TraJ family protein -
ECO26_RS30355 (ECO26_p2-40) 25922..26149 + 228 WP_000589558 conjugal transfer relaxosome protein TraY -
ECO26_RS30360 (ECO26_p2-41) 26183..26548 + 366 WP_000340274 type IV conjugative transfer system pilin TraA -
ECO26_RS30365 (ECO26_p2-42) 26563..26874 + 312 WP_000012106 type IV conjugative transfer system protein TraL traL
ECO26_RS30370 (ECO26_p2-43) 26896..27462 + 567 WP_000399792 type IV conjugative transfer system protein TraE traE
ECO26_RS30375 (ECO26_p2-44) 27449..28177 + 729 WP_001230787 type-F conjugative transfer system secretin TraK traK
ECO26_RS30380 (ECO26_p2-45) 28177..29604 + 1428 WP_000146635 F-type conjugal transfer pilus assembly protein TraB traB
ECO26_RS30385 (ECO26_p2-46) 29594..30181 + 588 WP_000002773 conjugal transfer pilus-stabilizing protein TraP -
ECO26_RS30390 (ECO26_p2-47) 30168..30488 + 321 WP_001057290 conjugal transfer protein TrbD virb4
ECO26_RS30395 (ECO26_p2-48) 30481..30732 + 252 WP_001038338 conjugal transfer protein TrbG -
ECO26_RS30400 (ECO26_p2-49) 30729..31244 + 516 WP_000809890 type IV conjugative transfer system lipoprotein TraV traV
ECO26_RS33555 (ECO26_p2-50) 31379..31600 + 222 WP_001278700 conjugal transfer protein TraR -
ECO26_RS30410 (ECO26_p2-51) 31593..32069 + 477 WP_000549578 hypothetical protein -
ECO26_RS30415 (ECO26_p2-52) 32149..32391 + 243 WP_000556753 hypothetical protein -
ECO26_RS34580 (ECO26_p2-53) 32393..32740 + 348 WP_000802782 hypothetical protein -
ECO26_RS30425 (ECO26_p2-54) 32865..35495 + 2631 WP_000069747 type IV secretion system protein TraC virb4
ECO26_RS30430 (ECO26_p2-55) 35492..35878 + 387 WP_000214096 type-F conjugative transfer system protein TrbI -
ECO26_RS30435 (ECO26_p2-56) 35875..36507 + 633 WP_001203735 type-F conjugative transfer system protein TraW traW
ECO26_RS30440 (ECO26_p2-57) 36504..37496 + 993 WP_000830838 conjugal transfer pilus assembly protein TraU traU
ECO26_RS30445 (ECO26_p2-58) 37505..38143 + 639 WP_000777701 type-F conjugative transfer system pilin assembly protein TrbC trbC
ECO26_RS30450 (ECO26_p2-59) 38140..38511 + 372 WP_000056336 hypothetical protein -
ECO26_RS30455 (ECO26_p2-60) 38537..38959 + 423 WP_001229309 HNH endonuclease signature motif containing protein -
ECO26_RS30460 (ECO26_p2-61) 38956..40806 + 1851 WP_000826170 type-F conjugative transfer system mating-pair stabilization protein TraN traN
ECO26_RS30465 (ECO26_p2-62) 40833..41090 + 258 WP_000864325 conjugal transfer protein TrbE -
ECO26_RS30470 (ECO26_p2-63) 41083..41826 + 744 WP_001030371 type-F conjugative transfer system pilin assembly protein TraF traF
ECO26_RS30475 (ECO26_p2-64) 41987..42223 + 237 WP_000270010 type-F conjugative transfer system pilin chaperone TraQ -
ECO26_RS30480 (ECO26_p2-65) 42210..42755 + 546 WP_000059817 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
ECO26_RS33565 (ECO26_p2-66) 42745..43059 + 315 WP_001384255 P-type conjugative transfer protein TrbJ -
ECO26_RS30485 (ECO26_p2-67) 43013..43405 + 393 WP_000126338 F-type conjugal transfer protein TrbF -
ECO26_RS30490 (ECO26_p2-68) 43392..43565 + 174 Protein_69 conjugal transfer protein TraH -
ECO26_RS30495 (ECO26_p2-69) 43592..43984 + 393 WP_000660703 F-type conjugal transfer protein TrbF -
ECO26_RS30500 (ECO26_p2-70) 43971..45344 + 1374 WP_001137363 conjugal transfer pilus assembly protein TraH traH
ECO26_RS30505 (ECO26_p2-71) 45341..48160 + 2820 WP_001007051 conjugal transfer mating-pair stabilization protein TraG traG
ECO26_RS30510 (ECO26_p2-72) 48179..48676 + 498 WP_000605862 entry exclusion protein -
ECO26_RS30515 (ECO26_p2-73) 48709..49440 + 732 WP_000850424 conjugal transfer complement resistance protein TraT -
ECO26_RS30520 (ECO26_p2-74) 49643..50380 + 738 WP_000199911 hypothetical protein -
ECO26_RS30525 (ECO26_p2-75) 50431..52629 + 2199 WP_000009352 type IV conjugative transfer system coupling protein TraD virb4

Host bacterium

ID   804 GenBank   NC_013362
Plasmid name   pO26_2 Incompatibility group   IncFIC(FII)
Plasmid size   63365 bp Coordinate of oriT [Strand]   24230..24503 [-]
Host baterium   Escherichia coli O26:H11 str. 11368

Cargo genes

Drug resistance gene   aph(3')-Ia
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -