Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100336
Name   oriT_SAP014A in_silico
Organism   Staphylococcus aureus
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NC_013320 (34439..34476 [-], 38 nt)
oriT length   38 nt
IRs (inverted repeats)      2..8, 13..19  (ACTTTAT..ATAAAGT)
Location of nic site      27..28
Conserved sequence flanking the
  nic site    		  GTG|TTA
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 38 nt

>oriT_SAP014A
CACTTTATGAATATAAAGTATAGTGTGTTATACTTTAC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   407 GenBank   YP_006937660
Name   PutativerelaxaseofSAP014A insolico UniProt ID   Q7DJ52
Length   420 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 420 a.a.        Molecular weight: 49660.33 Da        Isoelectric Point: 9.9693

>YP_006937660.1 Plasmid recombination enzyme (plasmid) [Staphylococcus aureus]
MSYAVCRMQKVKSAGLKGMQFHNQRERKSRTNDDIDHERTRENYDLKNDKNIDYNERVKEIIESQKTGTR
KTRKDAVLVNELLVTSDRDFFEQLDPGEQKRFFEESYKLFSERYGKQNIAYATVHNDEQTPHMHLGVVPM
RDGKLQGKNVFNRQELLWLQDKFPEHMKKQGFELKRGERGSDRKHIETAKFKKQTLEKEIDFLEKNLAVK
KDEWTAYSDKVKSDLEVPAKRHMKSVEVPTGEKSMFGLGKEIMKTEKKPTKNVVISERDYKNLVTAARDN
DRLKQHVRNLMSTDMAREYKKLSKEHGQVKEKYSGLVERFNENVNDYNELLEENKSLKSKISDLKRDVSL
IYESTKEFLKERTDGLKAFKNVFKGFVDKVKDKTAQFQEKHDLEPKKNEFELTHNREVKKERSRDQGMSL

  Protein domains


Predicted by InterproScan.

Plasmid recombination enzyme (Mob_Pre)

(1-193)


  Protein structure


Source ID Structure
AlphaFold DB Q7DJ52


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 39128..50349

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HHF09_RS00205 (SAP014A_041) 34876..35280 - 405 WP_001242578 bleomycin binding protein -
HHF09_RS00210 (SAP014A_042) 35497..36267 - 771 WP_001795128 aminoglycoside O-nucleotidyltransferase ANT(4')-Ia -
HHF09_RS00215 (SAP014A_043) 36427..36573 - 147 WP_001817822 hypothetical protein -
HHF09_RS00220 (SAP014A_044) 36617..37291 + 675 WP_001106019 IS6-like element IS257 family transposase -
HHF09_RS00225 (SAP014A_045) 37400..37588 - 189 WP_001063224 hypothetical protein -
HHF09_RS00230 (SAP014A_046) 37760..38734 + 975 WP_000368849 conjugative transfer protein TrsA -
HHF09_RS00235 (SAP014A_047) 38751..39068 + 318 WP_000591622 CagC family type IV secretion system protein -
HHF09_RS00240 (SAP014A_048) 39128..39535 + 408 WP_000110157 hypothetical protein trsC
HHF09_RS00245 (SAP014A_049) 39522..40205 + 684 WP_000979860 TrsD/TraD family conjugative transfer protein trsD
HHF09_RS00250 (SAP014A_050) 40220..42238 + 2019 WP_001795400 DUF87 domain-containing protein virb4
HHF09_RS00255 (SAP014A_051) 42250..43530 + 1281 WP_000702361 membrane protein trsF
HHF09_RS00260 (SAP014A_052) 43548..44624 + 1077 WP_012816481 CHAP domain-containing protein trsG
HHF09_RS00265 (SAP014A_053) 44634..45119 + 486 WP_000735569 TrsH/TraH family protein -
HHF09_RS00270 (SAP014A_054) 45135..47237 + 2103 WP_001094109 DNA topoisomerase III -
HHF09_RS00275 (SAP014A_055) 47253..47717 + 465 WP_000715273 hypothetical protein trsJ
HHF09_RS00280 (SAP014A_056) 47714..49354 + 1641 WP_000209436 VirD4-like conjugal transfer protein, CD1115 family -
HHF09_RS00285 (SAP014A_057) 49432..50349 + 918 WP_000383804 conjugal transfer protein TrbL family protein trsL

Host bacterium

ID   797 GenBank   NC_013320
Plasmid name   SAP014A Incompatibility group   _
Plasmid size   50429 bp Coordinate of oriT [Strand]   34439..34476 [-]
Host baterium   Staphylococcus aureus

Cargo genes

Drug resistance gene   resistance to tetracycline, teicoplanin, and bleomycin
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -