Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100334
Name   oriT_pAph01 in_silico
Organism   Candidatus Accumulibacter phosphatis
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NC_013193 (73854..73960 [-], 107 nt)
oriT length   107 nt
IRs (inverted repeats)      57..75, 78..96  (GTGAAGAAGGACAAGCCGC..GCGGGTGGGCCTACTTCAC)
Location of nic site      104..105
Conserved sequence flanking the
  nic site  
 
 TATCCTG|C
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 107 nt

>oriT_pAph01
CCGTCCGGCCTCGCAGAGCAGGACGCCCGTTGAGCACGCAGTGCGAATAAGGCGCAGTGAAGAAGGACAAGCCGCTTGCGGGTGGGCCTACTTCACCTATCCTGCCC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   405 GenBank   WP_012806752
Name   TraI_pAph01 insolico UniProt ID   C7RVW0
Length   741 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 741 a.a.        Molecular weight: 81965.40 Da        Isoelectric Point: 10.4515

>WP_012806752.1 TraI/MobA(P) family conjugative relaxase [Candidatus Accumulibacter regalis]
MIAKHVPMKSVRKSDFAGLVKYLIDEQQKRERVTGVSVTNCHAERPDAAILEVLNTQAQNRRAESDKTYH
LIVSFRAGEQPDAATLQAIEWRICEGLGYGEHQRVSTVHQDTDNLHLHIAINKIHPTRYTIHDPYRDHKT
LGELCEKLESEYGLQRDNHQAQKRGAENRADDMERHAGIESLLGWIRRECLEQIQGAQSWAELHQALRDN
GLEIRERGNGLVIADAAGTMVKASSVARELSLAKLEARFGRFEPSPERLANQADQPTRQYQPRPFRMRVD
TVELYARYRAEQQGHGAARTVEWTQARDRKSRLIEAAKRSGRLKRAAIKLMGGPGLSRKALYALTSRTLK
DELNQIHQQYRKERQAIHDKYRRQAWADWLRRKATEGDSEALAALRAREAALGLQGNTIAGNGGQQKGQG
VEAQQDGVTKKGTLIYRVGASAIRDDGDKLQVSRGATPDGLEAALRMAMARYGDRITVKGSAEFKESIAH
AAATADLPITFDDAALEQRRQTLLNEITAKENRHDASARTDRGRADRGRIRHPGPNATHPTGAGRRVGSA
AAPRATRKPNVGRVGRQPPPEAQNRLRSLSQLGLVRIASGSEVLLPGHVPDHLEHPGAQPDDGLRRGLAR
PGVAAVAGRAGPAPASSALAAVDKYIAEREEKRLAIFDIPKHRRYNENDSGAAIYAGSRQIDGHSLALLK
RGEEVIVLPINEATARRMQRLALGDPVTVTQGSIKMPGRSR

  Protein domains


Predicted by InterproScan.

(13-251)

(425-512)


  Protein structure


Source ID Structure
AlphaFold DB C7RVW0


T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 153606..164069

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CAP2UW1_RS22890 (CAP2UW1_4717) 148701..149780 - 1080 WP_008063278 signal peptidase II -
CAP2UW1_RS22895 (CAP2UW1_4718) 149777..152182 - 2406 WP_008063280 heavy metal translocating P-type ATPase -
CAP2UW1_RS22900 (CAP2UW1_4719) 152266..152706 + 441 WP_008063281 Cd(II)/Pb(II)-responsive transcriptional regulator -
CAP2UW1_RS22905 (CAP2UW1_4720) 152752..152988 - 237 Protein_140 hypothetical protein -
CAP2UW1_RS22910 (CAP2UW1_4721) 153007..153591 - 585 WP_012806820 TrbM/KikA/MpfK family conjugal transfer protein -
CAP2UW1_RS22915 (CAP2UW1_4722) 153606..155132 - 1527 WP_012806821 P-type conjugative transfer protein TrbL virB6
CAP2UW1_RS22920 (CAP2UW1_4723) 155141..155368 - 228 WP_012806822 entry exclusion lipoprotein TrbK -
CAP2UW1_RS22925 (CAP2UW1_4724) 155384..156187 - 804 WP_012806823 P-type conjugative transfer protein TrbJ virB5
CAP2UW1_RS22930 (CAP2UW1_4725) 156206..157645 - 1440 WP_199931765 TrbI/VirB10 family protein virB10
CAP2UW1_RS22935 (CAP2UW1_4726) 157664..158125 - 462 WP_012806825 conjugal transfer protein TrbH -
CAP2UW1_RS22940 (CAP2UW1_4727) 158128..159018 - 891 Protein_147 P-type conjugative transfer protein TrbG -
CAP2UW1_RS22945 (CAP2UW1_4728) 159032..159805 - 774 WP_012806826 conjugal transfer protein TrbF virB8
CAP2UW1_RS22950 (CAP2UW1_4729) 159802..162360 - 2559 WP_012806827 VirB4 family type IV secretion/conjugal transfer ATPase virb4
CAP2UW1_RS22955 (CAP2UW1_4730) 162357..162668 - 312 WP_012806828 conjugal transfer protein TrbD virB3
CAP2UW1_RS22960 (CAP2UW1_4731) 162671..163093 - 423 WP_012806829 conjugal transfer system pilin TrbC virB2
CAP2UW1_RS22965 (CAP2UW1_4732) 163107..164069 - 963 WP_012806830 P-type conjugative transfer ATPase TrbB virB11
CAP2UW1_RS22970 (CAP2UW1_4733) 164393..164764 - 372 WP_012806831 transcriptional regulator -
CAP2UW1_RS22975 (CAP2UW1_4734) 165190..166233 - 1044 WP_012806832 PDDEXK nuclease domain-containing protein -
CAP2UW1_RS22980 (CAP2UW1_4735) 166246..167226 - 981 WP_012806694 IS110 family transposase -


Host bacterium


ID   795 GenBank   NC_013193
Plasmid name   pAph01 Incompatibility group   _
Plasmid size   167595 bp Coordinate of oriT [Strand]   73854..73960 [-]
Host baterium   Candidatus Accumulibacter phosphatis

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   copper resistance
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -