Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100325
Name   oriT_pAM04528 in_silico
Organism   Salmonella enterica
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NC_012693 (51244..51794 [+], 551 nt)
oriT length   551 nt
IRs (inverted repeats)      IR1: 62..70, 71..79  (AACCCTTTC..GACAGGGTT)
  IR2: 143..150, 154..161  (TGGCCTGC..GGAGGCCA)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 551 nt

>oriT_pAM04528
TGTAAAGAGGCTGTGAAAGAATAAGAGCATCAAGATTCCAGATAGATAGAGGGAAATTTGACAAATTCCAAAGATGGGTTAGCCTAGTGACAGAACTAGATTCCAGTATTGGAATAATCAGCTTTAAATTCCAGATAGATAGTTATGTGGATAGGAATTGGATAGGAATTGGGAGGGTATTGAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   396 GenBank   YP_002894603
Name   TraI_pAM04528 insolico UniProt ID   C4NVE0
Length   990 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 990 a.a.        Molecular weight: 109356.90 Da        Isoelectric Point: 4.9395

>YP_002894603.1 TraI (plasmid) [Salmonella enterica]
MLKALNKLFGGRSGVIETAPSVRVLPLKDVEDEEIPRYPPFAKGLPVAPLDKILATQAELIEKVRNSLGF
TVDDFNRLVLPVIQRYAAFVHLLPASESHHHRGAGGLFRHGLEVAFWAAQASESVIFSIEGTPRERRDNE
PRWRLASCFSGLLHDVGKPLSDVSITDKDGSITWNPYSESLHDWAHRHEIDRYFIRWRDKRHKRHEQFSL
LAVDRIIPAETREFLSKSGPSIMEAMLEAISGTSVNQPVTKLMLRADQESVSRDLRQSRLDVDEFSYGVP
VERYVFDAIRRLVKTGKWKVNEPGAKVWHLNQGVFIAWKQLGDLYDLISHDKIPGIPRDPDTLADILIER
GFAVPNTVQEKGERAYYRYWEVLPEMLQEAAGSVKILMLRLESNDLVFTTEPPAAVAAEVVGDVEDAEIE
FVDPEEVDDDQEEDVSALNDDMLAAEQEAEKALAGLGFGDAMEMLKSTSDAVEEKPEQKDAGSTESSKPD
AGKKGKPQSKPGKAKPKSDTEKQPHKPEAKEDLSPQDIAKNAPPLANDNPLQALKDVGGGLGDIDFPFDA
FSASAETASTDATNSEIPDVAMPGKQEKQPKQDFVPQEQNSLQGDDFPMFGSSDEPPSWAIEPLPMLTDA
PEQTTPAPAMPPTDKPNLHEKDAKTLLVEMLAGYGEASALLEQAIMPVLEGKTTLGEVLCLMKGQAVILY
PDGARSLGAPSEVLSKLSHANAIVPDPIMPGRKVRDFSGVKAIVLAEQLSDAVVAAIKDAEASMGGYQDA
FELVSPPGLDASKNKSAPKQQSRKKAQQQKPEVNAGKPSPEQKAKGKDSQPQQKEKKVDVTSPVEEPQRQ
PVQEKQNVARLPKREVQPVAPEPKVEREKELGHVEVREREEPEVREFEPPKAKTNPKDINAEDFLPSGVT
PQKALQMLKDMIQKRSGRWLVTPVLEEDGCLVTSDKAFDMIAGENIGISKHILCGMLSRAQRRPLLKKRQ
GKLYLEVNET

  Protein domains


Predicted by InterproScan.

(51-357)


  Protein structure


Source ID Structure
AlphaFold DB C4NVE0


T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 49378..60809

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HS672_RS00350 (pAM04528_0065) 45409..45642 - 234 WP_001191890 hypothetical protein -
HS672_RS00355 (pAM04528_0066) 45624..46241 - 618 WP_001249395 hypothetical protein -
HS672_RS00360 (pAM04528_0067) 46409..49381 + 2973 WP_001326173 MobH family relaxase -
HS672_RS00365 (pAM04528_0068) 49378..51243 + 1866 WP_000178857 conjugative transfer system coupling protein TraD virb4
HS672_RS00370 (pAM04528_0069) 51254..51838 + 585 WP_000332868 hypothetical protein -
HS672_RS00375 (pAM04528_0070) 51795..52424 + 630 WP_000743449 DUF4400 domain-containing protein tfc7
HS672_RS00380 (pAM04528_0071) 52434..52880 + 447 WP_000122507 hypothetical protein -
HS672_RS00385 (pAM04528_0072) 52890..53267 + 378 WP_000869297 hypothetical protein -
HS672_RS00390 (pAM04528_0073) 53267..53929 + 663 WP_001231464 hypothetical protein -
HS672_RS00395 54110..54253 + 144 WP_001275801 hypothetical protein -
HS672_RS00400 (pAM04528_0074) 54265..54630 + 366 WP_001052530 hypothetical protein -
HS672_RS00405 (pAM04528_0075) 54775..55056 + 282 WP_000805625 type IV conjugative transfer system protein TraL traL
HS672_RS00410 (pAM04528_0076) 55053..55679 + 627 WP_001049717 TraE/TraK family type IV conjugative transfer system protein traE
HS672_RS00415 (pAM04528_0077) 55663..56580 + 918 WP_000794249 type-F conjugative transfer system secretin TraK traK
HS672_RS00420 (pAM04528_0078) 56580..57893 + 1314 WP_024131605 TraB/VirB10 family protein traB
HS672_RS00425 (pAM04528_0079) 57890..58468 + 579 WP_000793435 type IV conjugative transfer system lipoprotein TraV traV
HS672_RS00430 (pAM04528_0080) 58472..58864 + 393 WP_000479535 TraA family conjugative transfer protein -
HS672_RS00435 (pAM04528_0081) 59149..60108 + 960 Protein_87 IS1380-like element ISEcp1 family transposase -
HS672_RS00440 (pAM04528_0082) 60102..60809 - 708 WP_000637385 conjugal transfer protein TraC virb4
HS672_RS00445 (pAM04528_0083) 60806..61513 - 708 WP_001259346 DsbC family protein -

Region 2: 49378..60698

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HS672_RS00350 (pAM04528_0065) 45409..45642 - 234 WP_001191890 hypothetical protein -
HS672_RS00355 (pAM04528_0066) 45624..46241 - 618 WP_001249395 hypothetical protein -
HS672_RS00360 (pAM04528_0067) 46409..49381 + 2973 WP_001326173 MobH family relaxase -
HS672_RS00365 (pAM04528_0068) 49378..51243 + 1866 WP_000178857 conjugative transfer system coupling protein TraD virb4
HS672_RS00370 (pAM04528_0069) 51254..51838 + 585 WP_000332868 hypothetical protein -
HS672_RS00375 (pAM04528_0070) 51795..52424 + 630 WP_000743449 DUF4400 domain-containing protein tfc7
HS672_RS00380 (pAM04528_0071) 52434..52880 + 447 WP_000122507 hypothetical protein -
HS672_RS00385 (pAM04528_0072) 52890..53267 + 378 WP_000869297 hypothetical protein -
HS672_RS00390 (pAM04528_0073) 53267..53929 + 663 WP_001231464 hypothetical protein -
HS672_RS00395 54110..54253 + 144 WP_001275801 hypothetical protein -
HS672_RS00400 (pAM04528_0074) 54265..54630 + 366 WP_001052530 hypothetical protein -
HS672_RS00405 (pAM04528_0075) 54775..55056 + 282 WP_000805625 type IV conjugative transfer system protein TraL traL
HS672_RS00410 (pAM04528_0076) 55053..55679 + 627 WP_001049717 TraE/TraK family type IV conjugative transfer system protein traE
HS672_RS00415 (pAM04528_0077) 55663..56580 + 918 WP_000794249 type-F conjugative transfer system secretin TraK traK
HS672_RS00420 (pAM04528_0078) 56580..57893 + 1314 WP_024131605 TraB/VirB10 family protein traB
HS672_RS00425 (pAM04528_0079) 57890..58468 + 579 WP_000793435 type IV conjugative transfer system lipoprotein TraV traV
HS672_RS00430 (pAM04528_0080) 58472..58864 + 393 WP_000479535 TraA family conjugative transfer protein -
HS672_RS00435 (pAM04528_0081) 59149..60108 + 960 Protein_87 IS1380-like element ISEcp1 family transposase -
HS672_RS00440 (pAM04528_0082) 60102..60809 - 708 WP_000637385 conjugal transfer protein TraC -
HS672_RS00445 (pAM04528_0083) 60806..61513 - 708 WP_001259346 DsbC family protein -


Host bacterium


ID   786 GenBank   NC_012693
Plasmid name   pAM04528 Incompatibility group   IncA/C2
Plasmid size   158213 bp Coordinate of oriT [Strand]   51244..51794 [+]
Host baterium   Salmonella enterica

Cargo genes


Drug resistance gene   floR, tet(A), aph(6)-Id, aph(3'')-Ib, sul2, blaCMY-2
Virulence gene   -
Metal resistance gene   merE, merD, merB, merA, merP, merT, merR
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -