Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100312
Name   oriT_pMAR2 in_silico
Organism   Escherichia coli O127:H6 str. E2348/69
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NC_011603 (68315..68787 [+], 473 nt)
oriT length   473 nt
IRs (inverted repeats)      153..162, 165..174  (ATAGGGTCGT..ACGACCCTAT)
 242..249, 252..259  (GCAAAAAC..GTTTTTGC)
Location of nic site      268..269
Conserved sequence flanking the
  nic site    		  GTGGGGTGT|GG
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 473 nt

>oriT_pMAR2
AAGAAGAGCACCCCTAGCAGCGCCCCTAGGGGCATACTATAAAAAAACGCACGGCGCTGCTAGGGGCGGCCCTAATATATCCAAATGTTTTTCATGAAAATTGTCAGCACTGACCCTAACAAGGGTCGTCATAGGGTCGCTATAGGGTCGCTATAGGGTCGTCAACGACCCTATTTAATAATGTAAAATAAATTAAAATACATTATTTAGAACATAAACTAATGATTTAAAAAACAAATCAGCAAAAACTTGTTTTTGCGTGGGGTGTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTTGAGCCTTTTTGTGGAGTGGGTTAAATTATTTACGGATAAAGTCACCAGAGGTGGAAAAATGAAAAAATGGATGTTAGCCATCTGCCTGATGTTTATAAATGAGATCTGCCATGCCACTGATTGCTTTGATCTTGCAGGCCGGGATTACAAAATAGATCCTGATTTACTGAGA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   383 GenBank   WP_000986966
Name   TraI_pMAR2 insolico UniProt ID   B7UTI8
Length   1756 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 1756 a.a.        Molecular weight: 191989.80 Da        Isoelectric Point: 5.9726

>WP_000986966.1 conjugative transfer relaxase/helicase TraI [Escherichia coli]
MMSIAQVRSAGSAGNYYTDKDNYYVLGSMGERWAGRGAEQLGLQGSVDKDVFTRLLEGKLPDGADLSRMQ
DGSNKHRPGYDLTFSAPKSVSVMAMLGGDKRLIDAHNQAVDFAVRQVEALASTRVMTDGQSETVLTGNLV
MALFNHDTSRDQEPQLHTHAVVANVTQHNGEWKTLSSDKVGKTGFIENVYANQIAFGRLYREKLKEQVEA
LGYETEVVGKHGMWEMPGVPVEAFSGRSQAIREAVGEDASLKSRDVAALDTRKSKQHVDPEVRMAEWMQT
LKETGFDIRAYRDAADQRAETRTQTPGPASQDGPDVQQAVTQAIAGLSERKVQFTYTDVLARTVGILPPE
NGVIERARAGIDEAISREQLIPLDREKGLFTSGIHVLDELSVRALSRDIMKQNRVTVHPEKSVPRTAGYS
DAVSVLAQDRPSLAIVSGQGGAAGQRERVAELVMMAREQGREVQIIAADRRSQMNLKQDERLSGELITGR
RQLQEGMAFTPGNTVIVDQGEKLSLKETLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKDAGVNTYRW
QGGEQRPATIISEPDRNVRYARLAGDFAASVKAGEESVAQVSGVREQAILTQAIRSELKTQGVLGRPEVT
MTALSPVWLDSRSRYLRDMYRPGMVMEQWNPETRSHDRYVIDRVTAQSNSLTLRDAQGETQVVRISSLDS
SWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVASVSEDAMTVVVPGRAEPASLPVSDSPFMALKL
ENGWVETPGHSVSDSAKVFASVTQMAMDNATLNGLARSGRDVRLYSSLDETRTAEKLARHPSFTVVSEQI
KARAGETLLETAISLQKTGLHTPAQQAIHLALPVVESKNLAFSMVDLLTEAKSFAAEGTSFTELGGEINA
QIKRGDLLYVDVAKGYGTGLLVSRASYEAEKSILRHILEGKEAVTPLMERVPGELMEKLTSGQRAATRMI
LETSDRFTVVQGYAGVGKTTQFRAVMSAVNMLPESERPRVVGLGPTHRAVGEMRSAGVDAQTLASFLHDT
QLLQRSGETPNFSNTLFLLDESSMVGNTDMARAYALIAAGGGRAVASGDTDQLQAIAPGQPFRLQQTRSA
ADVAIMKEIVRQTPELREAVYSLINRDVERALSGLESVKPSQVPRQEGAWVPEHSVTEFSHSQEAKLAEA
QQKAMLKGEAFPDIPMTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIHDAREKAGELGKEQVM
VPVLNTANIRDGELRRLSTWETHRDALALVDNVYHRIAGISKDDGLITLQDAEGNTRLISPREAVAEGVT
LYTPDTIRVGTGDRMRFTKSDRERGYVANSVWTVTAVSGDSVTLSDGQQTRVIRPGQERAEQHIDLAYAI
TAHGAQGASETFAIALEGTEGNRKQMAGFESAYVALSRMKQHVQVYTDNRQGWTDAINNAVQKGTAHDVL
EPKSDREVMNAERLFSTARELRDVVAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDRNGKSAG
IWLNPLTTDDGNGLRGFSGEGREKGSGDAQFVALQGSRNGESLLADNMQDGVRIARDNPDSGVVVRIAGE
GRPWNPGTITGGRVWGDIPDNSVQPGAGNGEPVTAEVLAQRQAEEAIRRETERRADEIVRKMAENKPDLP
DGKTEQAVRDIAGLERDRSAISEREAALPESVLREPQRVREAVREVARENLLQERLQQMERDMVRDLQKE
KTLGGD

  Protein domains


Predicted by InterproScan.

single-stranded DNA binding TraI N-terminal subdomain (ssDNA_TraI_N)

(575-626)

AAA domain (AAA_30)

(969-1156)

TrwC relaxase (TrwC)

(10-283)

DNA helicase TraI (TraI_C)

(1434-1557)

DNA relaxase TraI 2B/2B-like domain (TraI_2B)

(633-712)


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 42886..69183

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E2348C_RS25610 (E2348_P1_043) 42252..42479 + 228 WP_000450520 toxin-antitoxin system antitoxin VapB -
E2348C_RS25615 (E2348_P1_044) 42479..42877 + 399 WP_000911313 type II toxin-antitoxin system VapC family toxin -
E2348C_RS25620 (E2348_P1_045) 42886..45039 - 2154 WP_000009324 type IV conjugative transfer system coupling protein TraD virb4
E2348C_RS25625 (E2348_P1_046) 45292..46023 - 732 WP_000850423 conjugal transfer complement resistance protein TraT -
E2348C_RS25630 (E2348_P1_047) 46037..46546 - 510 WP_000628106 conjugal transfer entry exclusion protein TraS -
E2348C_RS25635 (E2348_P1_048) 46543..49368 - 2826 WP_001007001 conjugal transfer mating-pair stabilization protein TraG traG
E2348C_RS25640 (E2348_P1_049) 49365..50738 - 1374 WP_000488447 conjugal transfer pilus assembly protein TraH traH
E2348C_RS25645 (E2348_P1_050) 50738..51118 - 381 WP_001411063 F-type conjugal transfer protein TrbF -
E2348C_RS25650 (E2348_P1_051) 51105..51446 - 342 WP_012477176 P-type conjugative transfer protein TrbJ -
E2348C_RS25655 (E2348_P1_052) 51376..51921 - 546 WP_000059835 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
E2348C_RS25660 (E2348_P1_053) 51908..52192 - 285 WP_000624108 type-F conjugative transfer system pilin chaperone TraQ -
E2348C_RS25665 (E2348_P1_054) 52273..52587 + 315 WP_000415570 hypothetical protein -
E2348C_RS25670 (E2348_P1_055) 52589..52936 - 348 WP_001287909 conjugal transfer protein TrbA -
E2348C_RS25675 (E2348_P1_056) 52952..53695 - 744 WP_001030379 type-F conjugative transfer system pilin assembly protein TraF traF
E2348C_RS25680 (E2348_P1_057) 53688..53945 - 258 WP_000864318 conjugal transfer protein TrbE -
E2348C_RS25685 (E2348_P1_058) 53973..55781 - 1809 WP_000821827 type-F conjugative transfer system mating-pair stabilization protein TraN traN
E2348C_RS25690 (E2348_P1_059) 55778..56416 - 639 WP_000777697 type-F conjugative transfer system pilin assembly protein TrbC trbC
E2348C_RS25695 (E2348_P1_060) 56425..57417 - 993 WP_000830821 conjugal transfer pilus assembly protein TraU traU
E2348C_RS25700 (E2348_P1_061) 57414..58046 - 633 WP_001203740 type-F conjugative transfer system protein TraW traW
E2348C_RS25705 (E2348_P1_062) 58043..58429 - 387 WP_000214079 type-F conjugative transfer system protein TrbI -
E2348C_RS25710 (E2348_P1_063) 58426..61053 - 2628 WP_001064253 type IV secretion system protein TraC virb4
E2348C_RS28080 (E2348_P1_064) 61213..61434 - 222 WP_001278689 conjugal transfer protein TraR -
E2348C_RS25720 (E2348_P1_065) 61569..62084 - 516 WP_000809838 type IV conjugative transfer system lipoprotein TraV traV
E2348C_RS25725 (E2348_P1_066) 62081..62332 - 252 WP_001038342 conjugal transfer protein TrbG -
E2348C_RS25730 (E2348_P1_067) 62325..62645 - 321 WP_001057294 conjugal transfer protein TrbD virb4
E2348C_RS25735 (E2348_P1_068) 62632..63222 - 591 WP_000002788 conjugal transfer pilus-stabilizing protein TraP -
E2348C_RS25740 (E2348_P1_069) 63212..64639 - 1428 WP_000146685 F-type conjugal transfer pilus assembly protein TraB traB
E2348C_RS25745 (E2348_P1_070) 64639..65367 - 729 WP_001230787 type-F conjugative transfer system secretin TraK traK
E2348C_RS25750 (E2348_P1_071) 65354..65920 - 567 WP_000399792 type IV conjugative transfer system protein TraE traE
E2348C_RS25755 (E2348_P1_072) 65942..66253 - 312 WP_000012106 type IV conjugative transfer system protein TraL traL
E2348C_RS25760 (E2348_P1_073) 66268..66633 - 366 WP_000340270 type IV conjugative transfer system pilin TraA -
E2348C_RS25765 (E2348_P1_074) 66667..66894 - 228 WP_012477178 conjugal transfer relaxosome protein TraY -
E2348C_RS25770 (E2348_P1_075) 66989..67675 - 687 WP_000332491 PAS domain-containing protein -
E2348C_RS25775 (E2348_P1_076) 67865..68248 - 384 WP_000124981 conjugal transfer relaxosome DNA-binding protein TraM -
E2348C_RS25780 (E2348_P1_077) 68581..69183 + 603 WP_012477179 transglycosylase SLT domain-containing protein virB1
E2348C_RS25785 (E2348_P1_078) 69479..70300 - 822 WP_001234454 DUF932 domain-containing protein -
E2348C_RS28705 (E2348_P1_079) 70419..70705 - 287 Protein_84 hypothetical protein -
E2348C_RS28830 70730..70849 - 120 WP_014106970 hypothetical protein -
E2348C_RS29360 70901..71317 + 417 Protein_86 hypothetical protein -
E2348C_RS28095 (E2348_P1_080) 71406..71558 - 153 Protein_87 class I SAM-dependent methyltransferase -
E2348C_RS25805 (E2348_P1_081) 71571..72944 - 1374 WP_000244358 IS4-like element ISEc13 family transposase -
E2348C_RS25810 (E2348_P1_082) 73051..73527 - 477 WP_000556070 class I SAM-dependent methyltransferase -

Host bacterium

ID   774 GenBank   NC_011603
Plasmid name   pMAR2 Incompatibility group   IncFIB
Plasmid size   97978 bp Coordinate of oriT [Strand]   68315..68787 [+]
Host baterium   Escherichia coli O127:H6 str. E2348/69

Cargo genes

Drug resistance gene   -
Virulence gene   bfpA, bfpG, bfpB, bfpC, bfpU, bfpD, bfpE, bfpF, bfpP, bfpH, bfpI, bfpJ, bfpK, bfpL
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -