Detailed information of oriT

oriT

The information of the oriT region

• oriTDB ID: 100291
• Name: oriT_pBS512_7
• Organism: Shigella boydii CDC 3083-94
• Sequence Completeness: core
• NCBI accession of oriT (coordinates [strand]): NC_010672 (7103..7160 [-], 58 nt)
• oriT length: 58 nt
• IRs (inverted repeats): 1..10, 14..23 (GTGTCGGGGC..GCCATGACCC)
• Location of nic site: 54..55
• Conserved sequence flanking the nic site: CAGG|CTTA
• Note: predicted by the oriTfinder

oriT sequence

• Length: 58 nt

>oriT_pBS512_7
GTGTCGGGGCGCAGCCATGACCCAGTCACGTCGCGATAGCGGAGTGTATACAGGCTTA

oriT secondary structure

Predicted by RNAfold.

Relaxase

MobC_pBS512_7

• ID: 362
• GenBank: WP_012421781
• Name: MobC_pBS512_7
• UniProt ID: B2TSK0
• Length: 107 a.a.
• Note: putative relaxase

Relaxase protein sequence

• Length: 107 a.a.
• Molecular weight: 11882.74 Da
• Isoelectric Point: 11.4917

>WP_012421781.1 MULTISPECIES: MobC family plasmid mobilization relaxosome protein [Shigella]
MLTIRVTDDEHARLLERCEGKQLAVWMRRVCLGEPVARSGRLPTLAPPLLRQLAAIGNNLNQAARKVNSG
QWSSGNRVQVVAALMAIGDELRRLRLAVREQGTRDDS

Protein domains

Predicted by InterproScan.

• Bacterial mobilisation protein (MobC) (MobC) (50-94)

Protein structure

• AlphaFold DB: B2TSK0

Host bacterium

• ID: 753
• GenBank: NC_010672
• Plasmid name: pBS512_7
• Incompatibility group: ColRNAI
• Plasmid size: 7437 bp
• Coordinate of oriT [Strand]: 7103..7160 [-]
• Host baterium: Shigella boydii CDC 3083-94

Cargo genes

• Drug resistance gene: -
• Virulence gene: -
• Metal resistance gene: -
• Degradation gene: -
• Symbiosis gene: -
• Anti-CRISPR: -