Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100273
Name   oriT_pP91278 in_silico
Organism   Photobacterium damselae subsp. piscicida
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NC_008613 (32153..32703 [+], 551 nt)
oriT length   551 nt
IRs (inverted repeats)      IR1: 62..70, 71..79  (AACCCTTTC..GACAGGGTT)
  IR2: 143..150, 154..161  (TGGCCTGC..GGAGGCCA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 551 nt

>oriT_pP91278
TGTAAAGAGGCTGTGAAAGAATAAGAGCATCAAGATTCCAGATAGATAGAGGGAAATTTGACAAATTCCAAAGATGGGTTAGCCTAGTGACAGAACTAGATTCCAGTATTGGAATAATCAGCTTTAAATTCCAGATAGATAGTTATGTGGATAGGAATTGGATAGGAATTGGGAGGGTATTGAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   344 GenBank   YP_908640
Name   Relaxase_pP91278 insolico UniProt ID   A0PAZ2
Length   992 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 992 a.a.        Molecular weight: 109581.85 Da        Isoelectric Point: 4.8956

>YP_908640.1 conjugative relaxase (plasmid) [Photobacterium damselae subsp. piscicida]
MLKALNKLFGGRSGVIETAPSARVLPLKDVEDEEIPRYPPFAKGLPVAPLDKILATQAELIEKVRNSLGF
TVDDFNRLVLPVIQRYAAFVHLLPASESHHHRGAGGLFRHGLEVAFWAAQASESVIFSIEGTPRERRDNE
PRWRLASCFSGLLHDVGKPLSDVSITDKDGSITWNPYSESLHDWAHRHEIDRYFIRWRDKRHKRHEQFSL
LAVDRIIPAETREFLSKSGPSIMEAMLEAISGTSVNQPVTKLMLRADQESVSRDLRQSRLDVDEFSYGVP
VERYVFDAIRRLVKTGKWKVNEPGAKVWHLNQGVFIAWKQLGDLYDLISHDKIPGIPRDPDTLADILIER
GFAVPNTVQEKGERAYYRYWEVLPEMLQEAAGSVKILMLRLESNDLVFTTEPPAAVAAEVVGDVEDAEIE
FVDPEEADDGDDQEEGEAALNDDMLAAEQEAEKALAGLGFGDAMEMLKSTSDAVEEKPEQKDAGPTESSK
PDAGKKGKPQSKPGKAKPKSDTEKQPHKPEAKEDLSPQDIAKNAPPLANDNPLQALKDVGGGLGDIDFPF
DAFNASAETTSTDATNSEIPDVAMPGKQEEQPKQDFVPQEQNSLQGDDFPMFGGSDEPPSWAIEPLPMLT
DAPEQPTHTPEMPHTDNVNQHEKDAKTLLVEMLSGYGEASALLEQAIMPVLEGKTTLGEVLCLMKGQAVI
LYPDGARSLGAPSEVLSKLSHANAIVPDPIMPGRKVRDFSGVKAIVLAEQLSDAVVAAIKDAEASMGGYQ
DAFELVSPPGLDASKNKSAPKQQSRKKAQQQKPEVNAGKASPEQKAKGKDSQPQPKEKKVDVTSPVEEQQ
RKPVQEKQNVARLPKREAQPVAPEPKVEREKELGHVEVREREDPEVREFEPPKAKTNPKDINAEDFLPSG
VTPQKALQMLKDMIQKRSGRWLVTPVLEEDGCLVTSDKAFDMIAGENIGISKHILCGMLSRAQRRPLLKK
RQGKLYLEVNET

  Protein domains


Predicted by InterproScan.

Putative helicase (TraI_2)

(51-357)


  Protein structure


Source ID Structure
AlphaFold DB A0PAZ2


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 30287..55478

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MTO85_RS00190 (P91278ORF_040) 26312..26545 - 234 WP_001191892 hypothetical protein -
MTO85_RS00195 (P91278ORF_041) 26527..27144 - 618 WP_001249396 hypothetical protein -
MTO85_RS00200 (P91278ORF_042) 27312..30290 + 2979 WP_001337757 MobH family relaxase -
MTO85_RS00205 (P91278ORF_043) 30287..32152 + 1866 WP_000178856 conjugative transfer system coupling protein TraD virb4
MTO85_RS00210 (P91278ORF_044) 32163..32747 + 585 WP_000332866 hypothetical protein -
MTO85_RS00215 (P91278ORF_045) 32704..33333 + 630 WP_000743450 DUF4400 domain-containing protein tfc7
MTO85_RS00220 (P91278ORF_046) 33343..33789 + 447 WP_000122506 hypothetical protein -
MTO85_RS00225 (P91278ORF_047) 33799..34176 + 378 WP_000869261 hypothetical protein -
MTO85_RS00230 (P91278ORF_048) 34176..34838 + 663 WP_001231463 hypothetical protein -
MTO85_RS00235 (P91278ORF_RS00250) 35019..35162 + 144 WP_001275801 hypothetical protein -
MTO85_RS00240 (P91278ORF_049) 35174..35539 + 366 WP_001052531 hypothetical protein -
MTO85_RS00245 (P91278ORF_050) 35684..35965 + 282 WP_000805625 type IV conjugative transfer system protein TraL traL
MTO85_RS00250 (P91278ORF_051) 35962..36588 + 627 WP_001049716 TraE/TraK family type IV conjugative transfer system protein traE
MTO85_RS00255 (P91278ORF_052) 36572..37489 + 918 WP_000794249 type-F conjugative transfer system secretin TraK traK
MTO85_RS00260 (P91278ORF_053) 37489..38802 + 1314 WP_024131605 TraB/VirB10 family protein traB
MTO85_RS00265 (P91278ORF_054) 38799..39377 + 579 WP_000793435 type IV conjugative transfer system lipoprotein TraV traV
MTO85_RS00270 (P91278ORF_055) 39381..39773 + 393 WP_000479535 TraA family conjugative transfer protein -
MTO85_RS00275 (P91278ORF_056) 39974..45505 + 5532 WP_000606833 Ig-like domain-containing protein -
MTO85_RS00280 (P91278ORF_057) 45654..46361 + 708 WP_001259347 DsbC family protein -
MTO85_RS00285 (P91278ORF_058) 46358..48805 + 2448 WP_000637386 type IV secretion system protein TraC virb4
MTO85_RS00290 (P91278ORF_059) 48820..49137 + 318 WP_000351984 hypothetical protein -
MTO85_RS00295 (P91278ORF_060) 49134..49664 + 531 WP_001010738 S26 family signal peptidase -
MTO85_RS00300 (P91278ORF_061) 49627..50892 + 1266 WP_000621288 TrbC family F-type conjugative pilus assembly protein traW
MTO85_RS00305 (P91278ORF_062) 50889..51560 + 672 WP_001337754 EAL domain-containing protein -
MTO85_RS00310 (P91278ORF_063) 51560..52564 + 1005 WP_043940352 TraU family protein traU
MTO85_RS00315 (P91278ORF_064) 52680..55478 + 2799 WP_001256487 conjugal transfer mating pair stabilization protein TraN traN
MTO85_RS00320 (P91278ORF_065) 55517..56377 - 861 WP_000709517 hypothetical protein -
MTO85_RS00325 (P91278ORF_066) 56500..57141 - 642 WP_000796664 hypothetical protein -
MTO85_RS00330 (P91278ORF_067) 57435..57755 + 321 WP_000547566 hypothetical protein -
MTO85_RS00335 (P91278ORF_068) 58059..58244 + 186 WP_001186917 hypothetical protein -
MTO85_RS00340 (P91278ORF_069) 58464..59432 + 969 WP_000085162 AAA family ATPase -
MTO85_RS00345 (P91278ORF_070) 59443..60351 + 909 WP_000739139 hypothetical protein -

Host bacterium

ID   735 GenBank   NC_008613
Plasmid name   pP91278 Incompatibility group   IncA/C2
Plasmid size   131520 bp Coordinate of oriT [Strand]   32153..32703 [+]
Host baterium   Photobacterium damselae subsp. piscicida

Cargo genes

Drug resistance gene   tet(D), sul2
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -