Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100272
Name   oriT_pP99-018 in_silico
Organism   Photobacterium damselae subsp. piscicida
Sequence Completeness      intact
NCBI accession of oriT (coordinates [strand])   NC_008612 (37699..38249 [+], 551 nt)
oriT length   551 nt
IRs (inverted repeats)      IR1: 62..70, 71..79  (AACCCTTTC..GACAGGGTT)
  IR2: 143..150, 154..161  (TGGCCTGC..GGAGGCCA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 551 nt

>oriT_pP99-018
TGTAAAGAGGCTGTGAAAGAATAAGAGCATCAAGATTCCAGATAGATAGAGGGAAATTTGACAAATTCCAAAGATGGGTTAGCCTAGTGACAGAACTAGATTCCAGTATTGGAATAATCAGCTTTAAATTCCAGATAGATAGTTATGTGGATAGGAATTGGATAGGAATTGGGAGGGTATTGAGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   343 GenBank   YP_908461
Name   Relaxase_pP99-018 insolico UniProt ID   A0PAZ2
Length   992 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 992 a.a.        Molecular weight: 109581.85 Da        Isoelectric Point: 4.8956

>YP_908461.1 conjugative relaxase (plasmid) [Photobacterium damselae subsp. piscicida]
MLKALNKLFGGRSGVIETAPSARVLPLKDVEDEEIPRYPPFAKGLPVAPLDKILATQAELIEKVRNSLGF
TVDDFNRLVLPVIQRYAAFVHLLPASESHHHRGAGGLFRHGLEVAFWAAQASESVIFSIEGTPRERRDNE
PRWRLASCFSGLLHDVGKPLSDVSITDKDGSITWNPYSESLHDWAHRHEIDRYFIRWRDKRHKRHEQFSL
LAVDRIIPAETREFLSKSGPSIMEAMLEAISGTSVNQPVTKLMLRADQESVSRDLRQSRLDVDEFSYGVP
VERYVFDAIRRLVKTGKWKVNEPGAKVWHLNQGVFIAWKQLGDLYDLISHDKIPGIPRDPDTLADILIER
GFAVPNTVQEKGERAYYRYWEVLPEMLQEAAGSVKILMLRLESNDLVFTTEPPAAVAAEVVGDVEDAEIE
FVDPEEADDGDDQEEGEAALNDDMLAAEQEAEKALAGLGFGDAMEMLKSTSDAVEEKPEQKDAGPTESSK
PDAGKKGKPQSKPGKAKPKSDTEKQPHKPEAKEDLSPQDIAKNAPPLANDNPLQALKDVGGGLGDIDFPF
DAFNASAETTSTDATNSEIPDVAMPGKQEEQPKQDFVPQEQNSLQGDDFPMFGGSDEPPSWAIEPLPMLT
DAPEQPTHTPEMPHTDNVNQHEKDAKTLLVEMLSGYGEASALLEQAIMPVLEGKTTLGEVLCLMKGQAVI
LYPDGARSLGAPSEVLSKLSHANAIVPDPIMPGRKVRDFSGVKAIVLAEQLSDAVVAAIKDAEASMGGYQ
DAFELVSPPGLDASKNKSAPKQQSRKKAQQQKPEVNAGKASPEQKAKGKDSQPQPKEKKVDVTSPVEEQQ
RKPVQEKQNVARLPKREAQPVAPEPKVEREKELGHVEVREREDPEVREFEPPKAKTNPKDINAEDFLPSG
VTPQKALQMLKDMIQKRSGRWLVTPVLEEDGCLVTSDKAFDMIAGENIGISKHILCGMLSRAQRRPLLKK
RQGKLYLEVNET

  Protein domains


Predicted by InterproScan.

Putative helicase (TraI_2)

(51-357)


  Protein structure


Source ID Structure
AlphaFold DB A0PAZ2


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 35833..61024

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MTO86_RS00230 (P99018ORF_048) 31858..32091 - 234 WP_001191892 hypothetical protein -
MTO86_RS00235 (P99018ORF_049) 32073..32690 - 618 WP_001249396 hypothetical protein -
MTO86_RS00240 (P99018ORF_050) 32858..35836 + 2979 WP_001337757 MobH family relaxase -
MTO86_RS00245 (P99018ORF_051) 35833..37698 + 1866 WP_000178856 conjugative transfer system coupling protein TraD virb4
MTO86_RS00250 (P99018ORF_052) 37709..38293 + 585 WP_000332866 hypothetical protein -
MTO86_RS00255 (P99018ORF_053) 38250..38879 + 630 WP_000743450 DUF4400 domain-containing protein tfc7
MTO86_RS00260 (P99018ORF_054) 38889..39335 + 447 WP_000122506 hypothetical protein -
MTO86_RS00265 (P99018ORF_055) 39345..39722 + 378 WP_000869261 hypothetical protein -
MTO86_RS00270 (P99018ORF_056) 39722..40384 + 663 WP_001231463 hypothetical protein -
MTO86_RS00275 (P99018ORF_RS00280) 40565..40708 + 144 WP_001275801 hypothetical protein -
MTO86_RS00280 (P99018ORF_057) 40708..41085 + 378 WP_000509509 hypothetical protein -
MTO86_RS00285 (P99018ORF_058) 41230..41511 + 282 WP_000805625 type IV conjugative transfer system protein TraL traL
MTO86_RS00290 (P99018ORF_059) 41508..42134 + 627 WP_001049716 TraE/TraK family type IV conjugative transfer system protein traE
MTO86_RS00295 (P99018ORF_060) 42118..43035 + 918 WP_000794249 type-F conjugative transfer system secretin TraK traK
MTO86_RS00300 (P99018ORF_061) 43035..44348 + 1314 WP_024131605 TraB/VirB10 family protein traB
MTO86_RS00305 (P99018ORF_062) 44345..44923 + 579 WP_000793435 type IV conjugative transfer system lipoprotein TraV traV
MTO86_RS00310 (P99018ORF_063) 44927..45319 + 393 WP_000479535 TraA family conjugative transfer protein -
MTO86_RS00315 (P99018ORF_064) 45520..51051 + 5532 WP_000606833 Ig-like domain-containing protein -
MTO86_RS00320 (P99018ORF_065) 51200..51907 + 708 WP_001259347 DsbC family protein -
MTO86_RS00325 (P99018ORF_066) 51904..54351 + 2448 WP_000637386 type IV secretion system protein TraC virb4
MTO86_RS00330 (P99018ORF_067) 54366..54683 + 318 WP_000351984 hypothetical protein -
MTO86_RS00335 (P99018ORF_068) 54680..55210 + 531 WP_001010738 S26 family signal peptidase -
MTO86_RS00340 (P99018ORF_069) 55173..56438 + 1266 WP_000621288 TrbC family F-type conjugative pilus assembly protein traW
MTO86_RS00345 (P99018ORF_070) 56435..57106 + 672 WP_001337754 EAL domain-containing protein -
MTO86_RS00350 (P99018ORF_071) 57106..58110 + 1005 WP_043940352 TraU family protein traU
MTO86_RS00355 (P99018ORF_072) 58226..61024 + 2799 WP_001256487 conjugal transfer mating pair stabilization protein TraN traN
MTO86_RS00360 (P99018ORF_073) 61063..61923 - 861 WP_000709517 hypothetical protein -
MTO86_RS00365 (P99018ORF_074) 62046..62687 - 642 WP_000796664 hypothetical protein -
MTO86_RS00370 (P99018ORF_075) 62981..63301 + 321 WP_000547566 hypothetical protein -
MTO86_RS00375 (P99018ORF_076) 63605..63790 + 186 WP_001186917 hypothetical protein -
MTO86_RS00380 (P99018ORF_077) 64010..64978 + 969 WP_000085162 AAA family ATPase -
MTO86_RS00385 (P99018ORF_078) 64989..65897 + 909 WP_000739139 hypothetical protein -

Host bacterium

ID   734 GenBank   NC_008612
Plasmid name   pP99-018 Incompatibility group   IncA/C2
Plasmid size   150157 bp Coordinate of oriT [Strand]   37699..38249 [+]
Host baterium   Photobacterium damselae subsp. piscicida

Cargo genes

Drug resistance gene   aph(3')-Ia, tet(D), catA1, sul2
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -