Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   100243
Name   oriT_pLW043 in_silico
Organism   Staphylococcus aureus
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NC_005054 (54976..55011 [+], 36 nt)
oriT length   36 nt
IRs (inverted repeats)      4..10, 14..20  (GCGAACG..CGTTCGC)
Location of nic site      31..32
Conserved sequence flanking the
  nic site  
 
 TAAGTGCGCC|CT
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 36 nt

>oriT_pLW043
CACGCGAACGGAACGTTCGCATAAGTGCGCCCTTAC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   314 GenBank   NP_878032
Name   nickingenzyme_pLW043 insolico UniProt ID   O87361
Length   665 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 665 a.a.        Molecular weight: 78908.86 Da        Isoelectric Point: 5.3910

>NP_878032.1 nicking enzyme (plasmid) [Staphylococcus aureus]
MAMYHFQNKFVSKANGQSATAKSAYNSASRIKDFKENEFKDYSNKQCDYSEILLPNNADDKFKDREYLWN
KVHDVENRKNSQVAREIIIGLPNEFDPNSNIELAKEFAESLSNEGMIVDLNIHKINEENPHAHLLCTLRG
LDKNNEFEPKRKGNDYIRDWNTKEKHNEWRKRWENVQNKHLEKNGFSVRVSADSYKNQNIDLEPTKKEGW
KARKFEDETGKKSSISKHNESIKKRNQQKIDKMFNEVDDMKSHKLNAFSYMNKSDSTTLKNMAKDLKIYV
TPINMYKENERLYDLKQKTSLITDDEDRLNKIEDIEDRQKKLESINEVFEKQAGIFFDKNYPDQSLNYSD
DEKIFITRTILNDRDVLPANNELEDIVKEKRIKEAQISLNTVLGNRDISLESIEKESNFFADKLSNILEK
NNLSFDDVLENKHEGMEDSLKIDYYTNKLEVFRNAENILEDYYDVQIKELFTDDEDYKAFNEVTDIKEKQ
QLIDFKTYHGTENTIEMLETGNFIPKYSDEDRKYITEQVKLLQEKEFKPNKNQHDKFVFGAIQKKLLSEY
DFDYSDNNDLKHLYQESNEVGDEISKDNIEEFYEGNDILVDKETYNNYNRKQQAYGLINAGLDSMIFNFN
EIFRERMPKYINHQYKGKNHSKQRHELKNKRGMHL

  Protein domains


Predicted by InterproScan.

(17-216)


  Protein structure


Source ID Structure
PDB 4HTE
AlphaFold DB O87361


T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 6425..17646

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
VRA_RS00015 (VRA0003) 1909..2307 - 399 Protein_2 DegV family protein -
VRA_RS00020 (VRA0004) 2317..2802 - 486 WP_000175735 trimethoprim-resistant dihydrofolate reductase DfrS1 -
VRA_RS00025 (VRA0005) 2844..3800 - 957 WP_000282655 thymidylate synthase -
VRA_RS00030 (VRA0006) 3914..4588 + 675 WP_001106019 IS6-like element IS257 family transposase -
VRA_RS00035 (VRA0007) 4697..4885 - 189 WP_001063224 hypothetical protein -
VRA_RS00040 (VRA0008) 5057..6031 + 975 WP_000368849 conjugative transfer protein TrsA -
VRA_RS00045 (VRA0009) 6048..6365 + 318 WP_000591622 CagC family type IV secretion system protein -
VRA_RS00050 (VRA0010) 6425..6832 + 408 WP_000110157 hypothetical protein trsC
VRA_RS00055 (VRA0011) 6819..7502 + 684 WP_000979860 TrsD/TraD family conjugative transfer protein trsD
VRA_RS00060 (VRA0012) 7517..9535 + 2019 WP_001795400 DUF87 domain-containing protein virb4
VRA_RS00065 (VRA0013) 9547..10827 + 1281 WP_000702363 membrane protein trsF
VRA_RS00070 (VRA0014) 10845..11921 + 1077 WP_000269385 CHAP domain-containing protein trsG
VRA_RS00075 (VRA0015) 11931..12416 + 486 WP_000735569 TrsH/TraH family protein -
VRA_RS00080 (VRA0016) 12432..14534 + 2103 WP_001094109 DNA topoisomerase III -
VRA_RS00085 (VRA0017) 14550..15014 + 465 WP_000715273 hypothetical protein trsJ
VRA_RS00090 (VRA0018) 15011..16651 + 1641 WP_000209436 VirD4-like conjugal transfer protein, CD1115 family -
VRA_RS00095 (VRA0019) 16729..17646 + 918 WP_000383804 conjugal transfer protein TrbL family protein trsL
VRA_RS00100 (VRA0020) 17663..18055 + 393 WP_000608970 single-stranded DNA-binding protein -
VRA_RS00105 (VRA0021) 18112..18279 + 168 WP_000869301 hypothetical protein -
VRA_RS00110 (VRA0022) 18317..18991 + 675 WP_001105984 IS6-like element IS257 family transposase -
VRA_RS00115 (VRA0023) 19095..20018 + 924 WP_001579520 protein rep -
VRA_RS00120 (VRA0025) 20551..20772 - 222 WP_000799767 hypothetical protein -
VRA_RS00125 (VRA0026) 20990..21313 - 324 WP_001146389 quaternary ammonium compound efflux SMR transporter QacC -
VRA_RS00130 21621..21851 + 231 WP_000956386 hypothetical protein -
VRA_RS00135 (VRA0027) 21881..22555 + 675 WP_001105984 IS6-like element IS257 family transposase -


Host bacterium


ID   705 GenBank   NC_005054
Plasmid name   pLW043 Incompatibility group   _
Plasmid size   57889 bp Coordinate of oriT [Strand]   54976..55011 [+]
Host baterium   Staphylococcus aureus

Cargo genes


Drug resistance gene   qacD, aac(6')-aph(2''), VanHAX, blaZ
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIIA21