Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100224
Name   oriT_Ti in_silico
Organism   Agrobacterium tumefaciens
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   NC_002377 (30720..30756 [+], 37 nt)
oriT length   37 nt
IRs (inverted repeats)      18..23, 27..32  (CGTCGT..ACGACG)
Location of nic site      7..8
Conserved sequence flanking the
  nic site    		  _
Note   predicted by the oriTfinder

  oriT sequence  


Download         Length: 37 nt

>oriT_Ti
CCAAGGGCGCAATTATACGTCGTGATACGACGCGTTG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   295 GenBank   NP_059695
Name   TraA_Ti insolico UniProt ID   Q44363
Length   1100 a.a. PDB ID   
Note   putative relaxase

  Relaxase protein sequence


Download         Length: 1100 a.a.        Molecular weight: 123724.31 Da        Isoelectric Point: 10.0043

>NP_059695.1 hypothetical protein pTi_023 (plasmid) [Agrobacterium tumefaciens]
MAIAHFSASIVSRGSGRSVVLSAAYRHCAKMEYEREARTIDYTRKQGLLHEEFVLPADAPKWVRSLIADR
SVSGASEAFWNKVEAFEKRADAQLARDLTIALPLELSAEQNIALVRDFVENHILAKGMVADWVYHENPGN
PHIHLMTTLRPLSDESFGSKKVAVIGEDGQPVRTKSGKILYELWAGSTDDFNVLRDGWFERLNHHLALGG
IDLKIDGRSYEKQGINLEPTIHLGVGAKAIERKAEQRGVRPELERVELNEQRRSENTRRILNNPAIVLDL
ITREKSVFDERDVAKVLHRYIDDPALFQQLMIKIILNRQVLRLQRETIDFSTGEKLPARYSTRAMIRLEA
TMARQATWLSNREGRGVSPTALDATFRRHERLSDEQKAAIEHVAGPARIAAVVGRAGAGKTTMMKAAREA
WELAGYHVVGGALAGKAAEGLEKEAGIQSRTLASWELRWKRGRDLLDDKTIFIMDEAGMVASKQMAGFVD
TAVRAGAKIVLVGDPEQLQPIEAGAAFRAIADRIGYAELETIYRQREEWMRKASLDLARGNVENALSAYR
ANVRITGERLKAEAVERLIADWNHDYDQTKTILILAHLRRDVRMLNVMAREKLVERGMVGEGHLFRTADG
ERRFDAGDQIVFLKNEGSLGLKNGMIGHVVVAAANRIVATVGEGDQRRQVIVEQRFYNNLDHGYATTIHK
SQGATVDRVKVLASLSLDRHLTYVAMTRHREDLQLYYGTRSFSFNGGLAKVLSRRQAKETTLDYEHGQFY
REALRFAETRGLHVVQVARTMVRDRLDWTLRQKAKLVDLSRRLAAFAAHLGITQSPKTQTMKETAPMVAG
IKTFSGSVSDIVGDRLGTDPSLKRQWEEVSARFAYVFADPETAFRAMNFAALLADKEVAKQILQKLEAEP
GSIGPLKGKTGILASKPEREARRVAEVNVPALKRDLEQYLRMRETVTQRLQTDEQSLRQRVSIDIPALSP
AARVVRERVRDAIDRNDLPAAIAYALSNRETKLEIDGFNQAVTERFGERTLLSNAAREPSGKLYEKLSEG
MKPEQKEELKQAWPVMRTAQQLVAHERTVHSLKLAEEHRLTQRQTPVLKQ

  Protein domains


Predicted by InterproScan.

BID domain of Bartonella effector protein (Bep) (Bep_C_terminal)

(855-951)

AAA domain (AAA_30)

(382-566)

Viral (Superfamily 1) RNA helicase (Viral_helicase1)

(692-736)

MobA/MobL family (MobA_MobL)

(17-243)


  Protein structure


Source ID Structure
AlphaFold DB Q44363


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 96666..106317

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HKJ77_RS00430 (pTi_075) 92102..92983 + 882 WP_010892435 ABC transporter permease -
HKJ77_RS00435 (pTi_076) 92983..94749 + 1767 WP_010892436 ABC transporter ATP-binding protein -
HKJ77_RS00440 (pTi_077) 94901..96433 + 1533 WP_323130362 ABC transporter substrate-binding protein -
HKJ77_RS00445 (pTi_078) 96666..97967 - 1302 WP_010892438 IncP-type conjugal transfer protein TrbI virB10
HKJ77_RS00450 (pTi_079) 97977..98453 - 477 WP_046205713 conjugal transfer protein TrbH -
HKJ77_RS00455 (pTi_080) 98453..99307 - 855 WP_010892440 P-type conjugative transfer protein TrbG virB9
HKJ77_RS00460 (pTi_081) 99324..99986 - 663 WP_010892441 conjugal transfer protein TrbF virB8
HKJ77_RS00465 (pTi_082) 100001..101188 - 1188 WP_010892442 P-type conjugative transfer protein TrbL virB6
HKJ77_RS00470 (pTi_083) 101182..101409 - 228 WP_010892443 entry exclusion protein TrbK -
HKJ77_RS00475 (pTi_084) 101406..102215 - 810 WP_010892444 P-type conjugative transfer protein TrbJ virB5
HKJ77_RS00480 (pTi_085) 102187..104649 - 2463 WP_010892445 conjugal transfer protein TrbE virb4
HKJ77_RS00485 (pTi_086) 104660..104959 - 300 WP_010892446 conjugal transfer protein TrbD virB3
HKJ77_RS00490 (pTi_087) 104952..105356 - 405 WP_010892447 conjugal transfer pilin TrbC virB2
HKJ77_RS00495 (pTi_088) 105346..106317 - 972 WP_010892448 P-type conjugative transfer ATPase TrbB virB11
HKJ77_RS00500 (pTi_089) 106314..106952 - 639 WP_010892449 acyl-homoserine-lactone synthase -
HKJ77_RS00505 (pTi_090) 107313..108530 + 1218 WP_010892450 plasmid partitioning protein RepA -
HKJ77_RS00510 (pTi_091) 108760..109770 + 1011 WP_040132353 plasmid partitioning protein RepB -
HKJ77_RS00515 (pTi_092) 109976..111295 + 1320 WP_010892452 plasmid replication protein RepC -

Region 2: 151232..160667

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HKJ77_RS00695 (pTi_126) 148762..149529 + 768 WP_010892486 AcvB/VirJ family lysyl-phosphatidylglycerol hydrolase -
HKJ77_RS00700 150091..150855 + 765 Protein_143 IS5 family transposase -
HKJ77_RS00705 (pTi_127) 151232..151951 + 720 WP_010892487 type IV secretion system lytic transglycosylase VirB1 virB1
HKJ77_RS00710 (pTi_128) 152023..152331 + 309 WP_233278929 pilin major subunit VirB2 virB2
HKJ77_RS00715 (pTi_129) 152331..152657 + 327 WP_010892489 type IV secretion system protein VirB3 virB3
HKJ77_RS00720 (pTi_130) 152657..155026 + 2370 WP_010892490 VirB4 family type IV secretion/conjugal transfer ATPase virb4
HKJ77_RS00725 (pTi_131) 155041..155703 + 663 WP_010892491 pilin minor subunit VirB5 -
HKJ77_RS00730 (pTi_132) 155800..156687 + 888 WP_010892492 type IV secretion system protein virB6
HKJ77_RS00735 (pTi_133) 156721..156888 + 168 WP_010892493 type IV secretion system lipoprotein VirB7 -
HKJ77_RS00740 (pTi_134) 156875..157588 + 714 WP_032489857 type IV secretion system protein VirB8 virB8
HKJ77_RS00745 (pTi_135) 157585..158466 + 882 WP_010892495 P-type conjugative transfer protein VirB9 virB9
HKJ77_RS00750 (pTi_136) 158463..159596 + 1134 WP_010892496 type IV secretion system protein VirB10 virB10
HKJ77_RS00755 (pTi_137) 159636..160667 + 1032 WP_010892497 P-type DNA transfer ATPase VirB11 virB11
HKJ77_RS00760 (pTi_138) 160799..161602 + 804 WP_032488325 response regulator -
HKJ77_RS00765 161661..162044 + 384 WP_153463909 hypothetical protein -
HKJ77_RS00770 162100..162399 - 300 Protein_157 transposase domain-containing protein -
HKJ77_RS00775 162427..164082 - 1656 WP_046205714 IS66-like element IS66 family transposase -
HKJ77_RS00780 164128..164475 - 348 WP_040132297 IS66 family insertion sequence element accessory protein TnpB -
HKJ77_RS00785 164472..164879 - 408 WP_040132299 transposase -

Host bacterium

ID   686 GenBank   NC_002377
Plasmid name   Ti Incompatibility group   _
Plasmid size   194140 bp Coordinate of oriT [Strand]   30720..30756 [+]
Host baterium   Agrobacterium tumefaciens

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -