Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 100208 |
| Name | oriT_pAM373  |
| Organism | Enterococcus faecalis |
| Sequence Completeness | incomplete |
| NCBI accession of oriT (coordinates [strand]) | NC_002630 (14431..14443 [-], 13 nt) |
| oriT length | 13 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | 6..7 |
| Conserved sequence flanking the nic site |
_ |
| Note | CloDF13 familiy |
oriT sequence
Download Length: 13 nt
TAAAATGGTCAGG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Reference
[1] Francia MV et al. (2004) A classification scheme for mobilization regions of bacterial plasmids. FEMS Microbiol Rev. 28(1):79-100. [PMID:14975531]
[2] Francia MV et al. (2002) Transfer origins in the conjugative Enterococcus faecalis plasmids pAD1 and pAM373: identification of the pAD1 nic site, a specific relaxase and a possible TraG-like protein. Mol Microbiol. 45(2):375-95. [PMID:12123451]
T4CP
| ID | 201 | GenBank | NP_072029 |
| Name | TraG_pAM373 |
UniProt ID | Q9F1G0 |
| Length | 423 a.a. | PDB ID | _ |
| Note | traG-related protein | ||
T4CP protein sequence
Download Length: 423 a.a. Molecular weight: 45315.71 Da Isoelectric Point: 7.2834
MNKKRIVFGLLSFFLPIFLVFGGLLFFLLLLTSTSDTSKNDCIQPSINNPTDATDTPKSIEQFVKSHKDA
YLLSWKAGGFLPSASISQTMVENGFNFTNPSGTSFWQAHNMGGVKTSKKEDFPVTLATFGQDSVDISGTK
PGSNVGDGTGGAYTWFKDYNAGIVGKAEFMAHQTLYTGAINNTDGLSTLSAIYSGGWATDPTYLMKLQAT
YNSLGKQFQWLDQEAIQKYGNAPFKKSELVPNIPGKSPITNEKSGKNSDCVVTSDTSDQVTGQNTAPSLE
VPSAYKGKLTLPPIDSNDYAGNNYPFGQCTWYAYNRMAQIGKPIEWFSGDGGNGAGWANSARAKGYTVVK
GKPSVGWAASMQGGIGGSAPPYGHVAVVEYVNSDGSILVSEANVINQGSGTRSWRVLDRATVEQIDFIQG
KGA
Protein domains
Predicted by InterproScan.
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q9F1G0 |
Reference
[1] Francia MV et al. (2004) A classification scheme for mobilization regions of bacterial plasmids. FEMS Microbiol Rev. 28(1):79-100. [PMID:14975531]
[2] Francia MV et al. (2002) Transfer origins in the conjugative Enterococcus faecalis plasmids pAD1 and pAM373: identification of the pAD1 nic site, a specific relaxase and a possible TraG-like protein. Mol Microbiol. 45(2):375-95. [PMID:12123451]
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 14650..29424
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HHI27_RS00050 (pAM373_p13) | 10702..11478 | - | 777 | WP_010904433 | Cas9 inhibitor AcrIIA9 family protein | - |
| HHI27_RS00055 (pAM373_p14) | 11639..11905 | - | 267 | WP_001245899 | hypothetical protein | - |
| HHI27_RS00060 | 11912..12094 | - | 183 | WP_141423022 | hypothetical protein | - |
| HHI27_RS00065 (pAM373_p18) | 12513..13001 | - | 489 | WP_010785699 | hypothetical protein | - |
| HHI27_RS00070 (pAM373_p19) | 13007..13792 | - | 786 | WP_010785700 | replication-relaxation family protein | - |
| HHI27_RS00075 (pAM373_p20) | 13789..13950 | - | 162 | WP_002399271 | hypothetical protein | - |
| HHI27_RS00080 (pAM373_p22) | 14283..14522 | - | 240 | WP_011109601 | hypothetical protein | - |
| HHI27_RS00085 (pAM373_p23) | 14650..16863 | - | 2214 | WP_010904438 | TraM recognition domain-containing protein | virb4 |
| HHI27_RS00090 (pAM373_p24) | 16850..19195 | - | 2346 | WP_010904439 | hypothetical protein | orf15 |
| HHI27_RS00095 (pAM373_p25) | 19213..19608 | - | 396 | WP_048670056 | lipoprotein | - |
| HHI27_RS00100 (pAM373_p26) | 19565..22057 | - | 2493 | WP_010904441 | ATP-binding protein | virb4 |
| HHI27_RS00105 (pAM373_p27) | 22114..23076 | + | 963 | WP_010714879 | hypothetical protein | - |
| HHI27_RS00110 (pAM373_p28) | 23014..23538 | - | 525 | WP_238819413 | hypothetical protein | - |
| HHI27_RS00115 (pAM373_p29) | 23613..24098 | - | 486 | WP_002365967 | single-stranded DNA-binding protein | - |
| HHI27_RS00120 (pAM373_p30) | 24255..24644 | - | 390 | WP_002360791 | TcpE family conjugal transfer membrane protein | orf17b |
| HHI27_RS00125 (pAM373_p31) | 24644..24904 | - | 261 | WP_233030092 | hypothetical protein | - |
| HHI27_RS00130 (pAM373_p32) | 24909..25943 | - | 1035 | WP_048952484 | conjugal transfer protein | orf13 |
| HHI27_RS00135 (pAM373_p33) | 25936..26250 | - | 315 | WP_002360796 | hypothetical protein | - |
| HHI27_RS00140 (pAM373_p34) | 26250..26618 | - | 369 | WP_002398540 | thioredoxin family protein | - |
| HHI27_RS00145 (pAM373_p35) | 26650..27267 | - | 618 | WP_002379926 | hypothetical protein | - |
| HHI27_RS00150 (pAM373_p36) | 27270..28541 | - | 1272 | WP_002385557 | CHAP domain-containing protein | trsG |
| HHI27_RS00155 (pAM373_p37) | 28567..29424 | - | 858 | WP_161797825 | LPXTG cell wall anchor domain-containing protein | prgC |
| HHI27_RS00160 (pAM373_p38) | 29447..30325 | - | 879 | WP_010904447 | hypothetical protein | - |
| HHI27_RS00165 (pAM373_p39) | 30336..30596 | - | 261 | WP_002370667 | hypothetical protein | - |
| HHI27_RS00170 (pAM373_p40) | 30645..31070 | - | 426 | WP_010774998 | PrgU family protein | - |
| HHI27_RS00175 (pAM373_p41) | 31140..33107 | - | 1968 | WP_010785648 | KxYKxGKxW signal peptide domain-containing protein | - |
| HHI27_RS00180 (pAM373_p43) | 33234..33548 | - | 315 | WP_010785647 | hypothetical protein | - |
| HHI27_RS00185 (pAM373_p44) | 33767..34024 | + | 258 | WP_080114736 | hypothetical protein | - |
| HHI27_RS00190 (pAM373_p45) | 34045..34356 | - | 312 | WP_010785646 | hypothetical protein | - |
Host bacterium
| ID | 201 | GenBank | NC_002630 |
| Plasmid name | pAM373 | Incompatibility group | - |
| Plasmid size | 36804 bp | Coordinate of oriT [Strand] | 14431..14443 [-] |
| Host baterium | Enterococcus faecalis |
Cargo genes
| Drug resistance gene | _ |
| Virulence gene | _ |
| Metal resistance gene | _ |
| Degradation gene | _ |
| Symbiosis gene | - |
| Anti-CRISPR | - |